SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33655_P050
Price: $0.00
SKU
ARP33655_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Bmi1 (ARP33655_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCK
Concentration0.5 mg/ml
Blocking PeptideFor anti-Bmi1 (ARP33655_P050) antibody is Catalog # AAP33655
Gene SymbolBmi1
Gene Full NameBmi1 polycomb ring finger oncogene
Alias SymbolsBmi, Bmi-, Pcgf, Bmi-1, Pcgf4, AW546694
NCBI Gene Id12151
Protein NamePolycomb complex protein BMI-1
Description of TargetBmi1 is a component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Uniprot IDP25916
Protein Accession #NP_031578
Nucleotide Accession #NM_007552
Protein Size (# AA)324
Molecular Weight37kDa
Protein InteractionsRnf2; Eed; Aurkb; Phc2; RING1; Gata6; Mph1; Cbfb; Runx1; Cdkn2a; HIST2H2AC; Slc11a1; Dnmt3b; Kdm2b; Phc1; Cbx2; Phc3; Dmap1; CBX8; SCMH1; CBX4; SMARCA5; HSPA4;
  1. What is the species homology for "Bmi1 Antibody - middle region (ARP33655_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "Bmi1 Antibody - middle region (ARP33655_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Bmi1 Antibody - middle region (ARP33655_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Bmi1 Antibody - middle region (ARP33655_P050)"?

    This target may also be called "Bmi, Bmi-, Pcgf, Bmi-1, Pcgf4, AW546694" in publications.

  5. What is the shipping cost for "Bmi1 Antibody - middle region (ARP33655_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Bmi1 Antibody - middle region (ARP33655_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Bmi1 Antibody - middle region (ARP33655_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Bmi1 Antibody - middle region (ARP33655_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BMI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BMI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BMI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BMI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BMI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BMI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Bmi1 Antibody - middle region (ARP33655_P050)
Your Rating
We found other products you might like!