BMF Antibody - N-terminal region (ARP43597_P050)

Catalog No: ARP43597_P050

Host: Rabbit
Target Name: BMF
Sample Type: Ovary Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BMF
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Goat: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BMF (ARP43597_P050) antibody is Catalog # AAP43597

Target Info

• Gene Symbol: BMF
• Gene Full Name: Bcl2 modifying factor
• Alias Symbols: BMF,
• NCBI Gene Id: 90427
• Protein Name: Bcl-2-modifying factor
• Description of Target: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: Q96LC9-3
• Protein Size (# AA): 129
• Molecular Weight: 14kDa
• Protein Interactions: SEC14L4; DYNLL2; TFIP11; REL; BCL2L2; BCL2L1; MCL1; BAG3; TCF12; NNMT; CXCL9; MAPK8; BCL2; DYNLL1; MYO5A; BCL2A1;