BLNK Antibody - N-terminal region (ARP81255_P050)

Catalog No: ARP81255_P050

Host: Rabbit
Target Name: BLNK
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BLNK
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BLNK (ARP81255_P050) antibody is Catalog # AAP81255

Target Info

• Gene Symbol: BLNK
• Gene Full Name: B-cell linker
• Alias Symbols: bca, AGM4, BASH, LY57, SLP65, BLNK-S, SLP-65
• NCBI Gene Id: 29760
• Protein Name: B-cell linker protein
• Description of Target: This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: Q8WV28
• Protein Accession #: NP_001107566.1
• Nucleotide Accession #: NM_001114094.1
• Protein Size (# AA): 456
• Molecular Weight: 50 kDa