Blmh Antibody - C-terminal region (ARP56105_P050)

Catalog No: ARP56105_P050

Host: Rabbit
Target Name: Blmh
Sample Type: Mouse Stomach lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Blmh
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: GPITPLQFYKEHVKPLFNMEDKICFVNDPRPQHKYNKLYTVDYLSNMVGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Blmh (ARP56105_P050) antibody is Catalog # AAP56105

Target Info

• Gene Symbol: Blmh
• Alias Symbols: Bh, Bmh, AI035728
• NCBI Gene Id: 104184
• Protein Name: Bleomycin hydrolase
• Description of Target: The encoded protein is a cytoplasmic cysteine peptidase involved in inactivation of bleomycin, a glycopeptide which is a component of combination chemotherapy regimens for cancer. This encoded enzyme is highly conserved, and it contains the signature active site residues of cysteine protease papain superfamily enzymes. It is postulated that this enzyme has protective effects against bleomycin-induced pulmonary fibrosis and bleomycin tumor resistance.
• Uniprot ID: Q8R016
• Protein Accession #: NP_848760
• Nucleotide Accession #: NM_178645
• Protein Size (# AA): 455
• Molecular Weight: 50kDa