- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-BLID (OAAN02196) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3. |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IF |
Additional Information | Positive samples: PC-3, A-549, SKOV3, MCF-7, Mouse spleen, Rat spleen Cellular location: Cytoplasm, Mitochondrion |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human BLID. |
Purification | Affinity purified |
Application Info | WB: 1:500 - 1:2,000 IF: 1:50 - 1:100 Optimal dilutions should be determined by the end user. |
Protein Sequence | MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL |
Gene Symbol | BLID |
---|---|
Gene Full Name | BH3-like motif containing, cell death inducer |
Alias Symbols | BRCC2 |
NCBI Gene Id | 414899 |
Protein Name | BH3-like motif-containing cell death inducer |
Description of Target | This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion. |
Uniprot ID | Q8IZY5 |
Protein Accession # | NP_001001786.2 |
Nucleotide Accession # | NM_001001786.2 |
Molecular Weight | 15 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "BLID Antibody (OAAN02196)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "BLID Antibody (OAAN02196)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "BLID Antibody (OAAN02196)" provided in?
This item is provided in "Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "BLID Antibody (OAAN02196)"?
This target may also be called "BRCC2" in publications.
-
What is the shipping cost for "BLID Antibody (OAAN02196)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "BLID Antibody (OAAN02196)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "BLID Antibody (OAAN02196)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "15 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "BLID Antibody (OAAN02196)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BLID"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BLID"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BLID"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BLID"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BLID"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BLID"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.