BLA Recombinant Protein (Escherichia coli) (OPCA02919)

Catalog No: OPCA02919

bla Recombinant Protein (Escherichia coli) (OPCA02919) in SDS-PAGE showing the molecular weight of approximately 30.9 kDa.

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Liquid or Lyophilized powder
• Host: Escherichia coli
• Additional Information: Relevance: T-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
• Protein Sequence: HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 24-286 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: A potent new mode of beta-lactamase inhibition revealed by the 1.7 A X-ray crystallographic structure of the TEM-1-BLIP complex.Strynadka N.C.J., Jensen S.E., Alzari P.M., James M.N.G.Nat. Struct. Biol. 3:290-297(1996)
• Gene Symbol: bla|blaTEM|blaTEM-1|D616_p1002|D616_p107018|D616_p108018|D616_p109104|D616_p127015|D616_p87011|D616_p89001|HUS41_pI0062|pIGAL1_03
• Gene Full Name: ampicillin resistance protein|beta-lactamase|beta-lactamase TEM|beta-lactamase TEM precursor|beta-lactamase TEM-1|blaTEM|class A beta lactamase TEM-1|extended spectrum beta lactamase TEM-1|TEM-1|TEM-1 beta-lactamase|TEM-1 beta-lactamse
• Alias Symbols: ampicillin resistance protein, beta-lactamase, beta-lactamase TEM, beta-lactamase TEM precursor, beta-lactamase TEM-1, blaTEM, class A beta lactamase TEM-1, D616_p1002, D616_p107018, D616_p108018, D616_p109104, D616_p118028, D616_p119009, D616_p121056, D616_p127015, D616_p137091, D616_p58029, D616_p59037, D616_p78029, D616_p87011, D616_p89001, extended spectrum beta lactamase TEM-1, HUS41_pI0062, IRT-4, NDM1Dok01_N0178, p3521_p066, p3521_p083, Penicillinase, pHN3A11_016, pHN7A8_020, pIGAL1_03, rpec180_8, TEM-1, TEM-1 beta-lactamase, TEM-1 beta-lactamse, TEM-16/CAZ-7, TEM-2, TEM-24/CAZ-6, TEM-3, TEM-4, TEM-5, TEM-6, TEM-8/CAZ-2.
• NCBI Gene Id: 10076131|10076142|13876868|13877052|13903673|13905334|13905363|13906404|13906709|13906924|13909533|13909568|14612524|17824300|17824435|18157686|20466965|20466993|20467118|20468340|20471961|3722457
• Protein Name: Beta-lactamase TEM
• Description of Target: TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
• Uniprot ID: P62593
• Protein Accession #: NP_943295.1
  
• Nucleotide Accession #: NC_005248.1
• Protein Size (# AA): Full Length of Mature Protein
• Molecular Weight: 30.9 kDa