Catalog No: OPCA02097
Price: $0.00
SKU
OPCA02097
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for BLA Recombinant Protein (Escherichia coli) (OPCA02097) |
---|
Predicted Species Reactivity | Escherichia coli |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Escherichia coli |
Additional Information | Relevance: T-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW |
Protein Sequence | HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 24-286 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | Beta-lactamase TEM1 of E. coli. Crystal structure determination at 2.5-A resolution.Jelsch C., Lenfant F., Masson J.-M., Samama J.-P.FEBS Lett. 299:135-142(1992) |
---|---|
Gene Symbol | bla|blaTEM|blaTEM-1|D616_p1002|D616_p107018|D616_p108018|D616_p109104|D616_p127015|D616_p87011|D616_p89001|HUS41_pI0062|pIGAL1_03 |
Gene Full Name | ampicillin resistance protein|beta-lactamase|beta-lactamase TEM|beta-lactamase TEM precursor|beta-lactamase TEM-1|blaTEM|class A beta lactamase TEM-1|extended spectrum beta lactamase TEM-1|TEM-1|TEM-1 beta-lactamase|TEM-1 beta-lactamse |
Alias Symbols | ampicillin resistance protein, beta-lactamase, beta-lactamase TEM, beta-lactamase TEM precursor, beta-lactamase TEM-1, blaTEM, class A beta lactamase TEM-1, D616_p1002, D616_p107018, D616_p108018, D616_p109104, D616_p118028, D616_p119009, D616_p121056, D616_p127015, D616_p137091, D616_p58029, D616_p59037, D616_p78029, D616_p87011, D616_p89001, extended spectrum beta lactamase TEM-1, HUS41_pI0062, IRT-4, NDM1Dok01_N0178, p3521_p066, p3521_p083, Penicillinase, pHN3A11_016, pHN7A8_020, pIGAL1_03, rpec180_8, TEM-1, TEM-1 beta-lactamase, TEM-1 beta-lactamse, TEM-16/CAZ-7, TEM-2, TEM-24/CAZ-6, TEM-3, TEM-4, TEM-5, TEM-6, TEM-8/CAZ-2. |
NCBI Gene Id | 10076131|10076142|13876868|13877052|13903673|13905334|13905363|13906404|13906709|13906924|13909533|13909568|14612524|17824300|17824435|18157686|20466965|20466993|20467118|20468340|20471961|3722457 |
Protein Name | Beta-lactamase TEM |
Description of Target | TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors. |
Uniprot ID | P62593 |
Protein Accession # | NP_943295.1 |
Nucleotide Accession # | NC_005248.1 |
Protein Size (# AA) | Full Length of Mature Protein |
Molecular Weight | 44.9 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!