Search Antibody, Protein, and ELISA Kit Solutions

BIK Antibody - N-terminal region : FITC (ARP75952_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75952_P050 Unconjugated

ARP75952_P050-HRP Conjugated

ARP75952_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-129222 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BIK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BIK.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BIK
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: SEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Blocking Peptide:
For anti-BIK (ARP75952_P050-FITC) antibody is Catalog # AAP75952
Printable datasheet for anti-BIK (ARP75952_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...