SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF07371 (Formerly GWB-ASB134)
Size:100 ug
Price: $344.00
SKU
OAAF07371
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for BID Antibody (Phospho-Ser78) (OAAF07371)
Product Info
Predicted Species ReactivityHuman|Mouse
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:S78 Mouse:S78
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human BID around the phosphorylation site of Ser78.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: LPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQV
Concentration1mg/ml
SpecificityBID (Phospho-Ser78) Antibody detects endogenous levels of BID only when phosphorylated at Ser78.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:5000
Gene SymbolBID
Gene Full NameBH3 interacting domain death agonist
Alias Symbolsapoptic death agonist;BH3-interacting domain death agonist;desmocollin type 4;FP497;Human BID coding sequence;p22 BID.
NCBI Gene Id637
Protein NameBH3-interacting domain death agonist
Description of TargetThe major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.
Uniprot IDP55957
Molecular Weight21 kDa
  1. What is the species homology for "BID Antibody (Phospho-Ser78) (OAAF07371)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".

  2. How long will it take to receive "BID Antibody (Phospho-Ser78) (OAAF07371)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "BID Antibody (Phospho-Ser78) (OAAF07371)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BID Antibody (Phospho-Ser78) (OAAF07371)"?

    This target may also be called "apoptic death agonist;BH3-interacting domain death agonist;desmocollin type 4;FP497;Human BID coding sequence;p22 BID." in publications.

  5. What is the shipping cost for "BID Antibody (Phospho-Ser78) (OAAF07371)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BID Antibody (Phospho-Ser78) (OAAF07371)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BID Antibody (Phospho-Ser78) (OAAF07371)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BID Antibody (Phospho-Ser78) (OAAF07371)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BID"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BID"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BID"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BID"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BID"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BID"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BID Antibody (Phospho-Ser78) (OAAF07371)
Your Rating
We found other products you might like!