Catalog No: ARP41474_T100
Price: $0.00
SKU
ARP41474_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BHMT (ARP41474_T100) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Fetal liver cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BHMT
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
Concentration1.0 mg/ml
Blocking PeptideFor anti-BHMT (ARP41474_T100) antibody is Catalog # AAP41474 (Previous Catalog # AAPS09308)
ReferenceCastro,C., (2004) Biochemistry 43 (18), 5341-5351
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

Maclean, K. N., Jiang, H., Greiner, L. S., Allen, R. H. & Stabler, S. P. Long-term betaine therapy in a murine model of cystathionine beta-synthase deficient homocystinuria: decreased efficacy over time reveals a significant threshold effect between elevated homocysteine and thrombotic risk. Mol. Genet. Metab. 105, 395-403 (2012). 22192524

Sex-specific dysregulation of cysteine oxidation and the methionine and folate cycles in female cystathionine gamma-lyase null mice: a serendipitous model of the methylfolate trap. Biol Open. 4, 1154-62 (2015). 26276101

Taurine alleviates repression of betaine-homocysteine S-methyltransferase and significantly improves the efficacy of long-term betaine treatment in a mouse model of cystathionine β-synthase-deficient homocystinuria. FASEB J. 33, 6339-6353 (2019) 30768359

Gene SymbolBHMT
Gene Full NameBetaine--homocysteine S-methyltransferase
Alias SymbolsBHMT1, HEL-S-61p
NCBI Gene Id635
Protein NameBetaine--homocysteine S-methyltransferase 1
Description of TargetBHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.Betaine-homocysteine methyltransferase is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in BHMT could lead to hyperhomocyst(e)inemia,but such a defect has not yet been observed.
Uniprot IDQ93088
Protein Accession #NP_001704
Nucleotide Accession #NM_001713
Protein Size (# AA)406
Molecular Weight45kDa
Protein InteractionsBHMT; BBS4; BBS2; BBS1; ALG9; LAMTOR3;
  1. What is the species homology for "BHMT Antibody - N-terminal region (ARP41474_T100)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "BHMT Antibody - N-terminal region (ARP41474_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BHMT Antibody - N-terminal region (ARP41474_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BHMT Antibody - N-terminal region (ARP41474_T100)"?

    This target may also be called "BHMT1, HEL-S-61p" in publications.

  5. What is the shipping cost for "BHMT Antibody - N-terminal region (ARP41474_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BHMT Antibody - N-terminal region (ARP41474_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BHMT Antibody - N-terminal region (ARP41474_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BHMT Antibody - N-terminal region (ARP41474_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BHMT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BHMT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BHMT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BHMT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BHMT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BHMT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BHMT Antibody - N-terminal region (ARP41474_T100)
Your Rating
We found other products you might like!