BHMT Antibody - N-terminal region (ARP41474_T100)

Catalog No: ARP41474_T100

WB Suggested Anti-BHMT Antibody
Titration: 2.5ug/ml
Positive Control: Human Fetal Liver cell lysate

Lanes:
Lane1: 20 ug rat liver lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:15000
Gene Name:
BHMT
Submitted by:
Anonymous

Lanes:
Lane1: 20 ug rat liver lysate
Primary Antibody Dilution:
1:2000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:15000
Gene Name:
BHMT
Submitted by:
Anonymous

Host: Rabbit
Target Name: BHMT
Sample Type: 293T
Antibody Dilution: 1.0ug/ml

Rabbit Anti-BHMT Antibody
Catalog Number: ARP41474
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Fetal liver cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BHMT
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-BHMT (ARP41474_T100) antibody is Catalog # AAP41474 (Previous Catalog # AAPS09308)
• Reference: Castro,C., (2004) Biochemistry 43 (18), 5341-5351
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

  Maclean, K. N., Jiang, H., Greiner, L. S., Allen, R. H. & Stabler, S. P. Long-term betaine therapy in a murine model of cystathionine beta-synthase deficient homocystinuria: decreased efficacy over time reveals a significant threshold effect between elevated homocysteine and thrombotic risk. Mol. Genet. Metab. 105, 395-403 (2012). 22192524

  Sex-specific dysregulation of cysteine oxidation and the methionine and folate cycles in female cystathionine gamma-lyase null mice: a serendipitous model of the methylfolate trap. Biol Open. 4, 1154-62 (2015). 26276101

  Taurine alleviates repression of betaine-homocysteine S-methyltransferase and significantly improves the efficacy of long-term betaine treatment in a mouse model of cystathionine β-synthase-deficient homocystinuria. FASEB J. 33, 6339-6353 (2019) 30768359

Target Info

• Gene Symbol: BHMT
• Gene Full Name: Betaine--homocysteine S-methyltransferase
• Alias Symbols: BHMT1, HEL-S-61p
• NCBI Gene Id: 635
• Protein Name: Betaine--homocysteine S-methyltransferase 1
• Description of Target: BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.Betaine-homocysteine methyltransferase is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in BHMT could lead to hyperhomocyst(e)inemia,but such a defect has not yet been observed.
• Uniprot ID: Q93088
• Protein Accession #: NP_001704
• Nucleotide Accession #: NM_001713
• Protein Size (# AA): 406
• Molecular Weight: 45kDa
• Protein Interactions: BHMT; BBS4; BBS2; BBS1; ALG9; LAMTOR3;