Search Antibody, Protein, and ELISA Kit Solutions

BHMT antibody - N-terminal region (ARP41474_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41474_T100-FITC Conjugated

ARP41474_T100-HRP Conjugated

ARP41474_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Betaine--homocysteine S-methyltransferase
Protein Name:
Betaine--homocysteine S-methyltransferase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-118805 from Santa Cruz Biotechnology.
Description of Target:
BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.Betaine-homocysteine methyltransferase is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in BHMT could lead to hyperhomocyst(e)inemia,but such a defect has not yet been observed.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BHMT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BHMT.
The immunogen is a synthetic peptide directed towards the N terminal region of human BHMT
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-BHMT (ARP41474_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BHMT (ARP41474_T100) antibody is Catalog # AAP41474 (Previous Catalog # AAPS09308)
Printable datasheet for anti-BHMT (ARP41474_T100) antibody
Additional Information:
IHC Information: Fetal liver cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Target Reference:
Castro,C., (2004) Biochemistry 43 (18), 5341-5351

Maclean, K. N., Jiang, H., Greiner, L. S., Allen, R. H. & Stabler, S. P. Long-term betaine therapy in a murine model of cystathionine beta-synthase deficient homocystinuria: decreased efficacy over time reveals a significant threshold effect between elevated homocysteine and thrombotic risk. Mol. Genet. Metab. 105, 395-403 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22192524

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Jiang, H; Hurt, KJ; Breen, K; Stabler, SP; Allen, RH; Orlicky, DJ; Maclean, KN; Sex-specific dysregulation of cysteine oxidation and the methionine and folate cycles in female cystathionine gamma-lyase null mice: a serendipitous model of the methylfolate trap. 4, 1154-62 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26276101

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...