- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-BHLHE40 (OAAN01860) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | LiquidPBS with 0.02% sodium azide, 50% glycerol, pH 7.3 |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC, IF |
Additional Information | Positive Samples: HepG2, Mouse kidney Cellular Location: Cytoplasm, Nucleus, Nucleolus |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 173-412 of human BHLHE40 (NP_003661.1). |
Purification | Affinity purified |
Peptide Sequence | THLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD |
Application Info | WB: 1:500~2000 IHC: 1:50~200 IF: 1:50~200 Optimal dilutions should be determined by the end user. |
Gene Symbol | BHLHE40 |
---|---|
Gene Full Name | basic helix-loop-helix family member e40 |
Alias Symbols | DEC1, HLHB2, BHLHB2, Clast5, SHARP2, STRA13, Stra14, SHARP-2 |
NCBI Gene Id | 8553 |
Protein Name | Class E basic helix-loop-helix protein 40 |
Description of Target | This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. |
Uniprot ID | O14503 |
Protein Accession # | NP_003661.1 |
Nucleotide Accession # | NM_003670.2 |
Molecular Weight | 48kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "BHLHE40 Antibody (OAAN01860)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "BHLHE40 Antibody (OAAN01860)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "BHLHE40 Antibody (OAAN01860)" provided in?
This item is provided in "LiquidPBS with 0.02% sodium azide, 50% glycerol, pH 7.3".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "BHLHE40 Antibody (OAAN01860)"?
This target may also be called "DEC1, HLHB2, BHLHB2, Clast5, SHARP2, STRA13, Stra14, SHARP-2" in publications.
-
What is the shipping cost for "BHLHE40 Antibody (OAAN01860)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "BHLHE40 Antibody (OAAN01860)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "BHLHE40 Antibody (OAAN01860)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "48kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "BHLHE40 Antibody (OAAN01860)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BHLHE40"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BHLHE40"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BHLHE40"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BHLHE40"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BHLHE40"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BHLHE40"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.