Beta-mammal toxin Css4 Recombinant Protein (Mexican scorpion) (OPCA02093)

Catalog No: OPCA02093

Beta-mammal toxin Css4 Recombinant Protein (Centruroides suffusus suffusus) (OPCA02093) in SDS-PAGE showing the molecular weight of approximately 23.61 kDa.

Product Info

• Predicted Species Reactivity: Centruroides suffusus
• Product Format: Liquid or Lyophilized powder
• Host: Centruroides suffusus suffusus
• Additional Information: Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
• Protein Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 20-85 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001)
• Alias Symbols: Css IV.
• Protein Name: Beta-mammal toxin Css4
• Description of Target: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
• Uniprot ID: P60266
• Protein Size (# AA): Recombinant
• Molecular Weight: 23.6 kDa