Beta-mammal toxin Cn2 Recombinant Protein (Mexican scorpion) (OPCA02922)

Catalog No: OPCA02922

Beta-mammal toxin Cn2 Recombinant Protein (Centruroides noxius) (OPCA02922) in SDS-PAGE showing the molecular weight of approximately 9.6 kDa.

Product Info

• Predicted Species Reactivity: Centruroides noxius
• Product Format: Liquid or Lyophilized powder
• Host: Centruroides noxius
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
• Protein Sequence: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 17-82 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Solution structure of toxin 2 from Centruroides noxius Hoffmann, a beta-scorpion neurotoxin acting on sodium channels.Pintar A., Possani L.D., Delepierre M.J. Mol. Biol. 287:359-367(1999)
• Alias Symbols: Toxin II.9.2.2.
• Protein Name: Beta-mammal toxin Cn2
• Description of Target: Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.
• Uniprot ID: P01495
• Protein Size (# AA): Full Length of Mature Protein
• Molecular Weight: 9.6 kDa