Search Antibody, Protein, and ELISA Kit Solutions

BECN1 Antibody - N-terminal region (ARP86768_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
beclin 1
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ATG6, VPS30, beclin1
Description of Target:
This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
52 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BECN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BECN1.
The immunogen is a synthetic peptide directed towards the N terminal region of Human BECN1
Peptide Sequence:
Synthetic peptide located within the following region: TTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSF
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BECN1 (ARP86768_P050) antibody is Catalog # AAP86768
Printable datasheet for anti-BECN1 (ARP86768_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...