Search Antibody, Protein, and ELISA Kit Solutions

BECN1 Antibody - middle region (ARP58874_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP58874_P050-FITC Conjugated

ARP58874_P050-HRP Conjugated

ARP58874_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-10086 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human BECN1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-BECN1 (ARP58874_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BECN1 (ARP58874_P050) antibody is Catalog # AAP58874 (Previous Catalog # AAPP44821)
Printable datasheet for anti-BECN1 (ARP58874_P050) antibody
Sample Type Confirmation:

BECN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

BECN1 is supported by BioGPS gene expression data to be expressed in HEK293


Lee, JW; Cho, KM; Jung, JH; Tran, Q; Jung, W; Park, J; Kim, KP; Alteration of Phospholipids during the Mitophagic Process in Lung Cancer Cells. 26, 1790-1799 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27363475

Gene Symbol:
Official Gene Full Name:
Beclin 1, autophagy related
Alias Symbols:
ATG6, VPS30, beclin1
NCBI Gene Id:
Protein Name:
Description of Target:
BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BECN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BECN1.
Protein Interactions:

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: BECN1 antibody-middle region (ARP58874_P050) in HEK lysate using Western blot
Product Page for BECN1 antibody-middle region (ARP58874_P050)

Researcher: Agathe Korniat INSERM/UPMC UMRS_956
Application: Western blotting
Species + Tissue/Cell type: 1: 50ug HEK lysate
Primary antibody dilution: 1:100
Secondary antibody: Anti-rabbit-RPF
Secondary antibody dilution: 1:10,000

How do Aviva's reagents play a role in your experimental goals? Need to have a working antibody for western that can target the endogenous Beclin1 protein
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4. It worked at a dilution 1:100 and has to be tested at a dilution 1:500 or 1:1000
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva's website is correct? Yes
How did you store the antibody after re-suspension?  -20C in small aliquots
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): HEK293 cells, Normally 50
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...