- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for Bcr Antibody (Phospho-Tyr360) (OAAF07515) |
|---|
| Predicted Species Reactivity | Human|Monkey|Mouse |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Additional Information | Modification Sites: Human:Y360 Mouse:Y362 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Bcr around the phosphorylation site of Tyr360. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: DCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDS |
| Concentration | 1mg/ml |
| Specificity | Bcr (Phospho-Tyr360) Antibody detects endogenous levels of Bcr only when phosphorylated at Tyr360. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | WB: 1:500~1:1000 IHC: 1:50~1:100 IF: 1:100~1:500 ELISA: 1:40000 |
| Gene Symbol | BCR |
|---|---|
| Gene Full Name | BCR activator of RhoGEF and GTPase |
| Alias Symbols | ALL;BCR, RhoGEF and GTPase activating protein;BCR/FGFR1 chimera protein;BCR1;breakpoint cluster region;breakpoint cluster region protein;CML;D22S11;D22S662;FGFR1/BCR chimera protein;PHL;renal carcinoma antigen NY-REN-26. |
| NCBI Gene Id | 613 |
| Protein Name | Breakpoint cluster region protein |
| Description of Target | GTPase-activating protein for RAC1 and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them. Displays serine/threonine kinase activity. |
| Uniprot ID | P11274 |
| Molecular Weight | 142 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Bcr Antibody (Phospho-Tyr360) (OAAF07515)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Monkey|Mouse".
-
How long will it take to receive "Bcr Antibody (Phospho-Tyr360) (OAAF07515)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Bcr Antibody (Phospho-Tyr360) (OAAF07515)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Bcr Antibody (Phospho-Tyr360) (OAAF07515)"?
This target may also be called "ALL;BCR, RhoGEF and GTPase activating protein;BCR/FGFR1 chimera protein;BCR1;breakpoint cluster region;breakpoint cluster region protein;CML;D22S11;D22S662;FGFR1/BCR chimera protein;PHL;renal carcinoma antigen NY-REN-26." in publications.
-
What is the shipping cost for "Bcr Antibody (Phospho-Tyr360) (OAAF07515)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Bcr Antibody (Phospho-Tyr360) (OAAF07515)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Bcr Antibody (Phospho-Tyr360) (OAAF07515)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "142 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Bcr Antibody (Phospho-Tyr360) (OAAF07515)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BCR"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BCR"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BCR"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BCR"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BCR"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BCR"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
