Search Antibody, Protein, and ELISA Kit Solutions

BCL7C Antibody - middle region (ARP83049_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
B-cell CLL/lymphoma 7C
NCBI Gene Id:
Protein Name:
B-cell CLL/lymphoma 7 protein family member C
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Description of Target:
This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
26 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BCL7C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BCL7C.
The immunogen is a synthetic peptide directed towards the middle region of human BCL7C
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: GRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BCL7C (ARP83049_P050) antibody is Catalog # AAP83049
Printable datasheet for anti-BCL7C (ARP83049_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...