BCL2L1 Antibody - N-terminal region (AVARP02002_P050)

Catalog No: AVARP02002_P050

WB Suggested Anti-BCL2L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Thymus

BCL2L1 antibody - N-terminal region (AVARP02002_P050) validated by WB using 1. H1299 (10ug)
2. LO2 (10ug)
3. NP361 (10ug)
4.-6. HeLA (10ug) at 1:1000.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BCL2L1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BCL2L1 (AVARP02002_P050) antibody is Catalog # AAP30258 (Previous Catalog # AAPP00428)
• Reference: Xu,C., (2008) J. Biol. Chem. 283 (17), 11477-11484

Target Info

• Gene Symbol: BCL2L1
• Gene Full Name: BCL2-like 1
• Alias Symbols: BCLX, BCL2L, Bcl-X, PPP1R52, BCL-XL/S
• NCBI Gene Id: 598
• Protein Name: Bcl-2-like protein 1
• Description of Target: BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.
• Uniprot ID: Q07817
• Protein Accession #: NP_612815
• Nucleotide Accession #: NM_138578
• Protein Size (# AA): 233
• Molecular Weight: 26kDa
• Protein Interactions: BCL2L1; BCL2; BAX; BAD; BMF; BBC3; CASP8AP2; BECN1; UBC; TPT1; TP53BP2; ced-9; ced-4; PGAM5; CDKN2A; CASP1; BCL2L11; HRK; PMAIP1; BIK; BID; PARK2; PINK1; BAK1; RAD9A; AKT1; Mapk1; ATXN3; CLU; BCAP31; CRYAB; CRYAA; BFAR; PPP1CC; PPP1CA; ACTB; UBR1; METTL23