Loading...
Catalog No: AVARP09047_P050
Price: $0.00
SKU
AVARP09047_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BCL2A1 (AVARP09047_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityRat, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human BCL2A1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 90%; Pig: 85%; Rat: 78%
Peptide SequenceSynthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY
Concentration0.5 mg/ml
Blocking PeptideFor anti-BCL2A1 (AVARP09047_P050) antibody is Catalog # AAP30560 (Previous Catalog # AAPP01212)
ReferenceKunter,U., et al., (2005) Kidney Int. 68 (4), 1520-1532
Gene SymbolBCL2A1
Gene Full NameBCL2-related protein A1
Alias SymbolsGRS, ACC1, ACC2, BFL1, ACC-1, ACC-2, HBPA1, BCL2L5
NCBI Gene Id597
Protein NameBcl-2-related protein A1
Description of TargetBCL2A1s a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and has been shown to be up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival.
Uniprot IDQ16548
Protein Accession #NP_004040
Nucleotide Accession #NM_004049
Protein Size (# AA)175
Molecular Weight20kDa
Protein InteractionsFAM9B; NR4A1; BIK; BAK1; APP; HAT1; BBC3; PMAIP1; BOK; BCL2L11; HRK; BAD; BID; BAX; GRB2; BMF;
  1. What is the species homology for "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Rat, Dog, Pig".

  2. How long will it take to receive "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)"?

    This target may also be called "GRS, ACC1, ACC2, BFL1, ACC-1, ACC-2, HBPA1, BCL2L5" in publications.

  5. What is the shipping cost for "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BCL2A1 Antibody - C-terminal region (AVARP09047_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BCL2A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BCL2A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BCL2A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BCL2A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BCL2A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BCL2A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BCL2A1 Antibody - C-terminal region (AVARP09047_P050)
Your Rating
We found other products you might like!