Search Antibody, Protein, and ELISA Kit Solutions

BCL11B Antibody - N-terminal region (ARP39819_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39819_P050-FITC Conjugated

ARP39819_P050-HRP Conjugated

ARP39819_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
BCL11B
Official Gene Full Name:
BCL11B, BAF complex component
NCBI Gene Id:
64919
Protein Name:
B-cell lymphoma/leukemia 11B
Swissprot Id:
Q9C0K0-2
Protein Accession #:
NP_612808
Nucleotide Accession #:
NM_138576.4
Alias Symbols:
ATL1, RIT1, CTIP2, IMD49, CTIP-2, IDDFSTA, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha
Description of Target:
This gene encodes a C2H2-type zinc finger protein and is closely related to BCL11A, a gene whose translocation may be associated with B-cell malignancies. Although the specific function of this gene has not been determined, the encoded protein is known to be a transcriptional repressor, and is regulated by the NURD nucleosome remodeling and histone deacetylase complex. Four alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein Size (# AA):
823
Molecular Weight:
88 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BCL11B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BCL11B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BCL11B
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-BCL11B (ARP39819_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HDAC6; HDAC2; HDAC1; NOTCH1; UBC; HDAC3; SUV39H1; tat; CBX5; NR2F1; SP1; MBD3; MTA2; MTA1; RBBP7; RBBP4; CHD4; NR2F2;
Blocking Peptide:
For anti-BCL11B (ARP39819_P050) antibody is Catalog # AAP39819
Datasheets/Manuals:
Printable datasheet for anti-BCL11B (ARP39819_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...