Search Antibody, Protein, and ELISA Kit Solutions

BCL-2 Antibody (Phospho-Thr56) (OAAF07689)

100 ug
$379.00
In Stock
Request Bulk Order Quote

Conjugation Options

OAAF07689-FITC Conjugated

OAAF07689-HRP Conjugated

OAAF07689-Biotin Conjugated

Gene Symbol:
BCL2
NCBI Gene Id:
10000
Swissprot Id:
P10415
Alias Symbols:
Apoptosis regulator Bcl-2, B-cell CLL/lymphoma 2, BCL2
Replacement Item:
This antibody may replace item sc-130307 from Santa Cruz Biotechnology.
Molecular Weight:
26 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Application:
WB, IHC, IP, IF
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BCL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BCL2.
Immunogen:
The antiserum was produced against synthesized peptide derived from human BCL-2 around the phosphorylation site of Thr56.
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTP
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF07689
Specificity:
BCL-2 (Phospho-Thr56) Antibody detects endogenous levels of BCL-2 only when phosphorylated at Thr56.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:20000
Additional Information:
Modification Sites: Human:T56

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...