Size:100 ul
$319.00
In stock
SKU
ARP56119_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56119_P050-FITC Conjugated

ARP56119_P050-HRP Conjugated

ARP56119_P050-Biotin Conjugated

BCKDHA Antibody - N-terminal region (ARP56119_P050)

Catalog#: ARP56119_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-105117 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BCKDHA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-BCKDHA (ARP56119_P050)
Peptide SequenceSynthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-BCKDHA (ARP56119_P050) antibody is Catalog # AAP56119 (Previous Catalog # AAPP37740)
Datasheets/ManualsPrintable datasheet for anti-BCKDHA (ARP56119_P050) antibody
Sample Type Confirmation

BCKDHA is supported by BioGPS gene expression data to be expressed in MCF7

Subunitalpha, mitochondrial
Target ReferenceFlaschker,N., (2007) J. Inherit. Metab. Dis. 30 (6), 903-909
Gene SymbolBCKDHA
Official Gene Full NameBranched chain keto acid dehydrogenase E1, alpha polypeptide
Alias SymbolsFLJ45695, MSU, MSUD1, OVD1A, BCKDE1A
NCBI Gene Id593
Protein Name2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
Description of TargetThe branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).The BCKDHA gene encodes the E1-alpha subunit of the branched-chain alpha-keto acid (BCAA) dehydrogenase complex (BCKD; EC 1.2.4.4), an inner-mitochondrial enzyme complex that catalyzes the oxidative decarboxylation of the branched-chain alpha-ketoacids derived from isoleucine, leucine, and valine. This reaction is the second major step in the catabolism of the branched-chain amino acids (Wynn et al., 1998 [PubMed 9582350]). The BCKD complex consists of 3 catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a homo-24-meric dihydrolipoyl transacylase (E2; MIM 248610), and a homodimeric dihydrolipoamide dehydrogenase (E3; MIM 238331). E1 is a thiamine pyrophosphate (TPP)-dependent enzyme. The reaction is irreversible and constitutes the first committed step in BCAA oxidation. The BCKDHB gene (MIM 248611) encodes the beta subunit of E1. The complex also contains 2 regulatory enzymes, a kinase and a phosphorylase.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-675 BI910860.1 12-686 676-1196 BG742673.1 80-600 1197-1731 BM702667.1 48-582 1732-1763 BE223026.1 1-32 c 1764-1781 BQ018849.1 1-18 c
Swissprot IdP12694
Protein Accession #NP_000700
Nucleotide Accession #NM_000709
Protein Size (# AA)445
Molecular Weight50kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express BCKDHA.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express BCKDHA.
Protein InteractionsUBC; CUL3; BCKDHB; BCKDK;
Write Your Own Review
You're reviewing:BCKDHA Antibody - N-terminal region (ARP56119_P050)
Your Rating
Assay Development
Aviva Travel Grant
Free Microscope
Aviva Pathways