Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44208_T100-FITC Conjugated

ARP44208_T100-HRP Conjugated

ARP44208_T100-Biotin Conjugated

BCHE Antibody - N-terminal region (ARP44208_T100)

Catalog#: ARP44208_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-377403, HPA001560
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BCHE
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-BCHE (ARP44208_T100)
Peptide Sequence Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BCHE (ARP44208_T100) antibody is Catalog # AAP44208 (Previous Catalog # AAPP11984)
Datasheets/Manuals Printable datasheet for anti-BCHE (ARP44208_T100) antibody
Target Reference 0

Mizukami, K; Akatsu, H; Abrahamson, EE; Mi, Z; Ikonomovic, MD; Immunohistochemical analysis of hippocampal butyrylcholinesterase: Implications for regional vulnerability in Alzheimer's disease. 36, 135-45 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26293308

Gene Symbol BCHE
Official Gene Full Name Butyrylcholinesterase
Alias Symbols CHE1, E1
NCBI Gene Id 590
Protein Name Cholinesterase
Description of Target Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
Swissprot Id P06276
Protein Accession # NP_000046
Nucleotide Accession # NM_000055
Protein Size (# AA) 602
Molecular Weight 68kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BCHE.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BCHE.
Protein Interactions COLQ; BCHE;
  1. What is the species homology for "BCHE Antibody - N-terminal region (ARP44208_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "BCHE Antibody - N-terminal region (ARP44208_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BCHE Antibody - N-terminal region (ARP44208_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "BCHE Antibody - N-terminal region (ARP44208_T100)"?

    This target may also be called "CHE1, E1" in publications.

  5. What is the shipping cost for "BCHE Antibody - N-terminal region (ARP44208_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BCHE Antibody - N-terminal region (ARP44208_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BCHE Antibody - N-terminal region (ARP44208_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BCHE Antibody - N-terminal region (ARP44208_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BCHE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BCHE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BCHE"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BCHE"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BCHE"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BCHE"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BCHE Antibody - N-terminal region (ARP44208_T100)
Your Rating
We found other products you might like!