Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP44208_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44208_T100-FITC Conjugated

ARP44208_T100-HRP Conjugated

ARP44208_T100-Biotin Conjugated

BCHE Antibody - N-terminal region (ARP44208_T100)

Catalog#: ARP44208_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-377403, HPA001560
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BCHE
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology dataAnti-BCHE (ARP44208_T100)
Peptide SequenceSynthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-BCHE (ARP44208_T100) antibody is Catalog # AAP44208 (Previous Catalog # AAPP11984)
Datasheets/ManualsPrintable datasheet for anti-BCHE (ARP44208_T100) antibody
Target Reference0
Publications

Mizukami, K; Akatsu, H; Abrahamson, EE; Mi, Z; Ikonomovic, MD; Immunohistochemical analysis of hippocampal butyrylcholinesterase: Implications for regional vulnerability in Alzheimer's disease. 36, 135-45 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26293308

Gene SymbolBCHE
Official Gene Full NameButyrylcholinesterase
Alias SymbolsCHE1, E1
NCBI Gene Id590
Protein NameCholinesterase
Description of TargetMutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
Swissprot IdP06276
Protein Accession #NP_000046
Nucleotide Accession #NM_000055
Protein Size (# AA)602
Molecular Weight68kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express BCHE.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express BCHE.
Protein InteractionsCOLQ; BCHE;
Write Your Own Review
You're reviewing:BCHE Antibody - N-terminal region (ARP44208_T100)
Your Rating
Assay Development
Aviva Travel Grant
Aviva Tissue Tool
Aviva Pathways