Search Antibody, Protein, and ELISA Kit Solutions

BCHE Antibody - N-terminal region (ARP44208_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44208_T100-FITC Conjugated

ARP44208_T100-HRP Conjugated

ARP44208_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
BCHE
Official Gene Full Name:
Butyrylcholinesterase
NCBI Gene Id:
590
Protein Name:
Cholinesterase
Swissprot Id:
P06276
Protein Accession #:
NP_000046
Nucleotide Accession #:
NM_000055
Alias Symbols:
CHE1, E1
Replacement Item:
This antibody may replace item sc-377403, HPA001560
Description of Target:
Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
Protein Size (# AA):
602
Molecular Weight:
68kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BCHE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BCHE.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BCHE
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-BCHE (ARP44208_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
COLQ; BCHE;
Blocking Peptide:
For anti-BCHE (ARP44208_T100) antibody is Catalog # AAP44208 (Previous Catalog # AAPP11984)
Datasheets/Manuals:
Printable datasheet for anti-BCHE (ARP44208_T100) antibody
Target Reference:
0
Publications:

Mizukami, K; Akatsu, H; Abrahamson, EE; Mi, Z; Ikonomovic, MD; Immunohistochemical analysis of hippocampal butyrylcholinesterase: Implications for regional vulnerability in Alzheimer's disease. 36, 135-45 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 26293308

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...