BCGAR1 Recombinant Protein (Botryotinia fuckeliana) (OPCA19808)

Catalog#: OPCA19808

• Predicted Species Reactivity: Botryotinia fuckeliana
• Product Format: Liquid
• Host: E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
• Application: WB, ELISA
• Additional Information: For Research Use Only.
  Sterile filtering available upon request.
  Low endotoxin available upon request.
• Reconstitution and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Gene Symbol: BCGAR1
• NCBI Gene Id: 5431046
• Protein Name: Bcgar1
• Swissprot Id: A6SDR8
• Protein Size (# AA): 221
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express BCGAR1.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MSFRGGSRGGRGTGANAGFSGGRGGFGGRGGGRGGFQQRDNGPPADVFAMGSFLHASEGEIVCESINTKIPYFNAPIYLENKTSIGKVDEILGPINQVYFTIKPTEGIQATSFKTGDKFYIGGDKLLPLEKFLPKPKPPPGAPKPKRAGGARGGRGGPMRGGRGGGRGAPRGGRGGFTPRGGSGGFSRGGGGGGFSRGGGGFTPRGGARGGSRGGFSRGGR
• Storage Buffer: Tris-based buffer,50% glycerol
• Tag: This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.

Protocol:

Tips Information: