SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP65409_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP65409_P050-Biotin
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ADT1 (ARP65409_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human BCAS1
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: GAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNG
Concentration0.5 mg/ml
Blocking PeptideFor anti-BCAS1 (ARP65409_P050-Biotin) antibody is Catalog # AAP65409
Gene SymbolBCAS1
Gene Full Namebreast carcinoma amplified sequence 1
Alias SymbolsAIBC1, NABC1, PMES-2
NCBI Gene Id8537
Protein Namebreast carcinoma-amplified sequence 1
Description of TargetThis gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDO75363
Protein Accession #NP_003648
Nucleotide Accession #NM_003657.2
Protein Size (# AA)584
Molecular Weight62 kDa
Protein InteractionsDYNLL1; BCAS1; RUVBL2;
  1. What is the species homology for "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)"?

    This target may also be called "AIBC1, NABC1, PMES-2" in publications.

  5. What is the shipping cost for "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "62 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BCAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BCAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BCAS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BCAS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BCAS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BCAS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BCAS1 Antibody - C-terminal region : Biotin (ARP65409_P050-Biotin)
Your Rating