Search Antibody, Protein, and ELISA Kit Solutions

BCAS1 Antibody - C-terminal region (ARP65409_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP65409_P050-FITC Conjugated

ARP65409_P050-HRP Conjugated

ARP65409_P050-Biotin Conjugated

Gene Symbol:
BCAS1
Official Gene Full Name:
breast carcinoma amplified sequence 1
NCBI Gene Id:
8537
Protein Name:
breast carcinoma-amplified sequence 1
Swissprot Id:
O75363
Protein Accession #:
NP_003648
Nucleotide Accession #:
NM_003657.2
Alias Symbols:
AIBC1, NABC1
Replacement Item:
This antibody may replace item sc-136342 from Santa Cruz Biotechnology.
Description of Target:
This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
584
Molecular Weight:
62 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BCAS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BCAS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human BCAS1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 79%
Complete computational species homology data:
Anti-BCAS1 (ARP65409_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DYNLL1; BCAS1; RUVBL2;
Blocking Peptide:
For anti-BCAS1 (ARP65409_P050) antibody is Catalog # AAP65409
Datasheets/Manuals:
Printable datasheet for anti-ADT1 (ARP65409_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...