Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP65409_P050-FITC Conjugated

ARP65409_P050-HRP Conjugated

ARP65409_P050-Biotin Conjugated

BCAS1 Antibody - C-terminal region (ARP65409_P050)

Catalog#: ARP65409_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-136342 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BCAS1
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 79%
Complete computational species homology data Anti-BCAS1 (ARP65409_P050)
Peptide Sequence Synthetic peptide located within the following region: GAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BCAS1 (ARP65409_P050) antibody is Catalog # AAP65409
Datasheets/Manuals Printable datasheet for anti-ADT1 (ARP65409_P050) antibody
Gene Symbol BCAS1
Official Gene Full Name breast carcinoma amplified sequence 1
Alias Symbols AIBC1, NABC1
NCBI Gene Id 8537
Protein Name breast carcinoma-amplified sequence 1
Description of Target This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id O75363
Protein Accession # NP_003648
Nucleotide Accession # NM_003657.2
Protein Size (# AA) 584
Molecular Weight 62 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BCAS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BCAS1.
Protein Interactions DYNLL1; BCAS1; RUVBL2;
  1. What is the species homology for "BCAS1 Antibody - C-terminal region (ARP65409_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "BCAS1 Antibody - C-terminal region (ARP65409_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "BCAS1 Antibody - C-terminal region (ARP65409_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "BCAS1 Antibody - C-terminal region (ARP65409_P050)"?

    This target may also be called "AIBC1, NABC1" in publications.

  5. What is the shipping cost for "BCAS1 Antibody - C-terminal region (ARP65409_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BCAS1 Antibody - C-terminal region (ARP65409_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BCAS1 Antibody - C-terminal region (ARP65409_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "62 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BCAS1 Antibody - C-terminal region (ARP65409_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BCAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BCAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BCAS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BCAS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BCAS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BCAS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BCAS1 Antibody - C-terminal region (ARP65409_P050)
Your Rating