BBS4 Antibody - N-terminal region : FITC (ARP57695_P050-FITC)

Catalog No: ARP57695_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BBS4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BBS4 (ARP57695_P050-FITC) antibody is Catalog # AAP57695 (Previous Catalog # AAPP42942)

Target Info

• Gene Symbol: BBS4
• Gene Full Name: Bardet-Biedl syndrome 4
• Alias Symbols: -
• NCBI Gene Id: 585
• Protein Name: Bardet-Biedl syndrome 4 protein
• Description of Target: This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport. The protein encoded by this gene has sequence similarity to O-linked N-acetylglucosamine (O-GlcNAc) transferases in plants and archaebacteria and in human forms a multi-protein "BBSome" complex with six other BBS proteins. Alternative splice variants have been described but their predicted protein products have not been experimentally verified.
• Uniprot ID: Q96RK4
• Protein Accession #: NP_149017
• Nucleotide Accession #: NM_033028
• Protein Size (# AA): 519
• Molecular Weight: 58kDa
• Protein Interactions: MYOG; HSCB; FHOD1; EXOC7; EIF3A; PCM1; PAX2; KRT18; EPAS1; EEF1A1; DCTN1; CALCA; BHMT; ALDOB; ACTB; CUL3; UBC;