SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF07835 (Formerly GWB-ASB969)
Size:100 ug
Price: $344.00
SKU
OAAF07835
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for Bax Antibody (Phospho-Ser184) (OAAF07835)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin
Additional InformationModification Sites: Human:S184 Mouse:S184 Rat:S184
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human Bax around the phosphorylation site of Ser184.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: FLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Concentration1mg/ml
SpecificityBax (Phospho-Ser184) Antibody detects endogenous levels of Bax only when phosphorylated at Ser184.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:10000
Gene SymbolBAX
Gene Full NameBCL2 associated X, apoptosis regulator
Alias Symbolsapoptosis regulator BAX;Baxdelta2G9;Baxdelta2G9omega;Baxdelta2omega;BCL2 associated X protein;BCL2-associated X protein omega;bcl2-L-4;BCL2L4;bcl-2-like protein 4.
NCBI Gene Id581
Protein NameApoptosis regulator BAX
Description of TargetPlays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM) (PubMed:21458670). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Uniprot IDQ07812
Molecular Weight21 kDa
  1. What is the species homology for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "Bax Antibody (Phospho-Ser184) (OAAF07835)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "Bax Antibody (Phospho-Ser184) (OAAF07835)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?

    This target may also be called "apoptosis regulator BAX;Baxdelta2G9;Baxdelta2G9omega;Baxdelta2omega;BCL2 associated X protein;BCL2-associated X protein omega;bcl2-L-4;BCL2L4;bcl-2-like protein 4." in publications.

  5. What is the shipping cost for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BAX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BAX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BAX"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BAX"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BAX"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BAX"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Bax Antibody (Phospho-Ser184) (OAAF07835)
Your Rating
We found other products you might like!