- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for Bax Antibody (Phospho-Ser184) (OAAF07835) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin |
Additional Information | Modification Sites: Human:S184 Mouse:S184 Rat:S184 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human Bax around the phosphorylation site of Ser184. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: FLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG |
Concentration | 1mg/ml |
Specificity | Bax (Phospho-Ser184) Antibody detects endogenous levels of Bax only when phosphorylated at Ser184. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IHC: 1:50~1:100 ELISA: 1:10000 |
Gene Symbol | BAX |
---|---|
Gene Full Name | BCL2 associated X, apoptosis regulator |
Alias Symbols | apoptosis regulator BAX;Baxdelta2G9;Baxdelta2G9omega;Baxdelta2omega;BCL2 associated X protein;BCL2-associated X protein omega;bcl2-L-4;BCL2L4;bcl-2-like protein 4. |
NCBI Gene Id | 581 |
Protein Name | Apoptosis regulator BAX |
Description of Target | Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM) (PubMed:21458670). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. |
Uniprot ID | Q07812 |
Molecular Weight | 21 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "Bax Antibody (Phospho-Ser184) (OAAF07835)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Bax Antibody (Phospho-Ser184) (OAAF07835)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?
This target may also be called "apoptosis regulator BAX;Baxdelta2G9;Baxdelta2G9omega;Baxdelta2omega;BCL2 associated X protein;BCL2-associated X protein omega;bcl2-L-4;BCL2L4;bcl-2-like protein 4." in publications.
-
What is the shipping cost for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "21 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Bax Antibody (Phospho-Ser184) (OAAF07835)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BAX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BAX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BAX"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BAX"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BAX"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BAX"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.