Loading...
Catalog No: AVARP02020_T100
Price: $0.00
SKU
AVARP02020_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BAX (AVARP02020_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BAX
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Pig: 100%
Peptide SequenceSynthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
Concentration1.0 mg/ml
Blocking PeptideFor anti-BAX (AVARP02020_T100) antibody is Catalog # AAP30231 (Previous Catalog # AAPP00401)
ReferenceYamaguchi,H., et al., (2004) J. Biol. Chem. 279 (38), 39431-39437
Publications

De Martino, L. et al. Bid cleavage, cytochrome c release and caspase activation in canine coronavirus-induced apoptosis. Vet. Microbiol. 141, 36-45 (2010). 19781871

Honda, A. et al. Activation of caspase 3, 9, 12, and Bax in masseter muscle of mdx mice during necrosis. J. Muscle Res. Cell Motil. 28, 243-7 (2007). 17952618

Gene SymbolBAX
Gene Full NameBCL2-associated X protein
Alias SymbolsBCL2L4
NCBI Gene Id581
Protein NameApoptosis regulator BAX
Description of TargetBAX encodes a protein that belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. BAX expression is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.
Uniprot IDQ07812
Protein Accession #NP_620116
Nucleotide Accession #NM_138761
Protein Size (# AA)192
Molecular Weight21kDa
Protein InteractionsCYCS; ZBTB24; UBC; CASP9; CASP8; CASP7; CASP3; BCL2L1; BCL2; CLU; MDM2; MCL1; BAX; BAG3; YWHAB; VCP; CRYAB; CRYAA; BAK1; XIAP; TP53; KCNA3; HSPA4; XRCC6; XRCC5; HDAC6; BAD; PSMC5; PSMC3; PARK7; UHRF2; RNF144B; OYE2; TOMM22; TOMM40; MEPCE; MOAP1; BBC3; PPP
  1. What is the species homology for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Pig".

  2. How long will it take to receive "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BAX Antibody - N-terminal region (AVARP02020_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    This target may also be called "BCL2L4" in publications.

  5. What is the shipping cost for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BAX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BAX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BAX"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BAX"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BAX"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BAX"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BAX Antibody - N-terminal region (AVARP02020_T100)
Your Rating
We found other products you might like!