Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP02020_T100-FITC Conjugated

AVARP02020_T100-HRP Conjugated

AVARP02020_T100-Biotin Conjugated

BAX Antibody - N-terminal region (AVARP02020_T100)

Catalog#: AVARP02020_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20067 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BAX
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Pig: 100%
Complete computational species homology data Anti-BAX (AVARP02020_T100)
Peptide Sequence Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BAX (AVARP02020_T100) antibody is Catalog # AAP30231 (Previous Catalog # AAPP00401)
Datasheets/Manuals Printable datasheet for anti-BAX (AVARP02020_T100) antibody
Target Reference Yamaguchi,H., et al., (2004) J. Biol. Chem. 279 (38), 39431-39437

De Martino, L. et al. Bid cleavage, cytochrome c release and caspase activation in canine coronavirus-induced apoptosis. Vet. Microbiol. 141, 36-45 (2010). IHC, WB, Cow, Dog, Human, Pig 19781871

Honda, A. et al. Activation of caspase 3, 9, 12, and Bax in masseter muscle of mdx mice during necrosis. J. Muscle Res. Cell Motil. 28, 243-7 (2007). IHC, WB, Cow, Dog, Human, Pig 17952618

Gene Symbol BAX
Official Gene Full Name BCL2-associated X protein
Alias Symbols BCL2L4
NCBI Gene Id 581
Protein Name Apoptosis regulator BAX
Description of Target BAX encodes a protein that belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. BAX expression is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.
Swissprot Id Q07812
Protein Accession # NP_620116
Nucleotide Accession # NM_138761
Protein Size (# AA) 192
Molecular Weight 21kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BAX.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BAX.
  1. What is the species homology for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Human, Pig".

  2. How long will it take to receive "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BAX Antibody - N-terminal region (AVARP02020_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    This target may also be called "BCL2L4" in publications.

  5. What is the shipping cost for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BAX Antibody - N-terminal region (AVARP02020_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BAX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BAX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BAX"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BAX"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BAX"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BAX"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BAX Antibody - N-terminal region (AVARP02020_T100)
Your Rating