Search Antibody, Protein, and ELISA Kit Solutions

BAX Antibody - N-terminal region (AVARP02020_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP02020_T100-FITC Conjugated

AVARP02020_T100-HRP Conjugated

AVARP02020_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Human, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
BAX
Official Gene Full Name:
BCL2-associated X protein
NCBI Gene Id:
581
Protein Name:
Apoptosis regulator BAX
Swissprot Id:
Q07812
Protein Accession #:
NP_620116
Nucleotide Accession #:
NM_138761
Alias Symbols:
BCL2L4
Replacement Item:
This antibody may replace item sc-20067 from Santa Cruz Biotechnology.
Description of Target:
BAX encodes a protein that belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. BAX expression is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.
Protein Size (# AA):
192
Molecular Weight:
21kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BAX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BAX.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BAX
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Pig: 100%
Complete computational species homology data:
Anti-BAX (AVARP02020_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CYCS; ZBTB24; UBC; CASP9; CASP8; CASP7; CASP3; BCL2L1; BCL2; CLU; MDM2; MCL1; BAX; BAG3; YWHAB; VCP; CRYAB; CRYAA; BAK1; XIAP; TP53; KCNA3; HSPA4; XRCC6; XRCC5; HDAC6; BAD; PSMC5; PSMC3; PARK7; UHRF2; RNF144B; OYE2; TOMM22; TOMM40; MEPCE; MOAP1; BBC3; PPP
Blocking Peptide:
For anti-BAX (AVARP02020_T100) antibody is Catalog # AAP30231 (Previous Catalog # AAPP00401)
Datasheets/Manuals:
Printable datasheet for anti-BAX (AVARP02020_T100) antibody
Target Reference:
Yamaguchi,H., et al., (2004) J. Biol. Chem. 279 (38), 39431-39437
Publications:

De Martino, L. et al. Bid cleavage, cytochrome c release and caspase activation in canine coronavirus-induced apoptosis. Vet. Microbiol. 141, 36-45 (2010). IHC, WB, Cow, Dog, Human, Pig 19781871

Honda, A. et al. Activation of caspase 3, 9, 12, and Bax in masseter muscle of mdx mice during necrosis. J. Muscle Res. Cell Motil. 28, 243-7 (2007). IHC, WB, Cow, Dog, Human, Pig 17952618

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...