Bax Antibody - middle region (ARP58871_P050)

Catalog No: ARP58871_P050

Host: Rabbit
Target Name: Bax
Sample Type: Rat Testis lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Bax
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PQDASTKKLSECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Bax (ARP58871_P050) antibody is Catalog # AAP58871

Target Info

• Gene Symbol: Bax
• Gene Full Name: BCL2-associated X protein
• Alias Symbols: -
• NCBI Gene Id: 24887
• Protein Name: Apoptosis regulator BAX Ensembl ENSRNOP00000028328
• Description of Target: Bax is a bcl2-related gene and is involved in the regulation of apoptotic cell death.
• Uniprot ID: G3V8T9
• Protein Accession #: NP_058755
• Nucleotide Accession #: NM_017059
• Protein Size (# AA): 192
• Molecular Weight: 21kDa
• Protein Interactions: Hspd1; Mcl1; Bcl2;