BATF Antibody - N-terminal (ARP73764_P050)

Catalog No: ARP73764_P050

Host: Rabbit
Target Name: BATF
Sample Type: Rat Muscle
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat BATF
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BATF (ARP73764_P050) antibody is Catalog # AAP73764

Target Info

• Gene Symbol: BATF
• Alias Symbols: B-ATF
• NCBI Gene Id: 299206
• Description of Target: BATF is a AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system: specifically mediates the differentiation of T-helper 17 cells (Th17), follicular T-helper cells (TfH), CD8(+) dendritic cells and class-switch recombination (CSR) in B-cells. It acts via the formation of a heterodimer with JUNB that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3'. The BATF-JUNB heterodimer also forms a complex with IRF4 (or IRF8) in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune- specific regulatory element, followed by cooperative binding of BATF and IRF4 (or IRF8) and activation of genes. It controls differentiation of T-helper cells producing interleukin-17 (Th17 cells) by binding to Th17-associated gene promoters: regulates expression of the transcription factor RORC itself and RORC target genes such as IL17 (IL17A or IL17B). Also involved in differentiation of follicular T-helper cells (TfH) by directing expression of BCL6 and MAF. In B-cells, involved in class-switch recombination (CSR) by controlling the expression of both AICDA and of germline transcripts of the intervening heavy-chain region and constant heavy-chain region (I(H)-C(H)).
• Uniprot ID: D4A7E1
• Protein Accession #: XP_008762980.1
• Protein Size (# AA): 125
• Molecular Weight: 13 kDa