Search Antibody, Protein, and ELISA Kit Solutions

BAT1 Antibody - C-terminal region (ARP36372_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36372_P050-FITC Conjugated

ARP36372_P050-HRP Conjugated

ARP36372_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
DDX39B
Official Gene Full Name:
DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
NCBI Gene Id:
7919
Protein Name:
Spliceosome RNA helicase DDX39B
Swissprot Id:
Q13838
Protein Accession #:
NP_542165
Nucleotide Accession #:
NM_080598
Alias Symbols:
BAT1, UAP56, D6S81E
Description of Target:
BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly. A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. This protein is a negative regulator of inflammation. It is also thought to be a translation initiation factor. This gene is a strong candidate gene for rheumatoid arthritis. There are multiple alternatively spliced transcript variants known for this gene but only two have been fully described. Both of these variants encode the same isoform. This gene has been found to have multiple polyadenylation sites.
Protein Size (# AA):
428
Molecular Weight:
47kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BAT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BAT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human BAT1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-BAT1 (ARP36372_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
THOC3; THOC2; ALYREF; NCBP1; STAU1; SHFM1; UBC; MDM2; WWOX; SUZ12; EED; RNF2; BMI1; RBBP4; C12orf10; NDRG1; HSPD1; GSR; SRPK2; UBD; VCAM1; ITGA4; IL7R; FN1; ATF2; BARD1; WIBG; MAGOHB; WDR74; VPS33B; LSM4; THOC1; RBM8A; DHX38; TXNL1; UBE3A; RPS7; EIF4A2; R
Blocking Peptide:
For anti-DDX39B (ARP36372_P050) antibody is Catalog # AAP36372 (Previous Catalog # AAPP08430)
Datasheets/Manuals:
Printable datasheet for anti-DDX39B (ARP36372_P050) antibody
Sample Type Confirmation:

DDX39B is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Allcock,R.J., et al., (2001) Genes Cells 6 (5), 487-494
Publications:

Bouley, J. et al. Proteomic analysis of BRCA1-depleted cell line reveals a putative role for replication protein A2 up-regulation in BRCA1 breast tumor development. Proteomics. Clin. Appl. 4, 489-98 (2010). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21137066

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...