Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP36372_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36372_P050-FITC Conjugated

ARP36372_P050-HRP Conjugated

ARP36372_P050-Biotin Conjugated

BAT1 Antibody - C-terminal region (ARP36372_P050)

Catalog#: ARP36372_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human BAT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-BAT1 (ARP36372_P050)
Peptide Sequence Synthetic peptide located within the following region: YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DDX39B (ARP36372_P050) antibody is Catalog # AAP36372 (Previous Catalog # AAPP08430)
Datasheets/Manuals Printable datasheet for anti-DDX39B (ARP36372_P050) antibody
Sample Type Confirmation

DDX39B is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Allcock,R.J., et al., (2001) Genes Cells 6 (5), 487-494
Publications

Bouley, J. et al. Proteomic analysis of BRCA1-depleted cell line reveals a putative role for replication protein A2 up-regulation in BRCA1 breast tumor development. Proteomics. Clin. Appl. 4, 489-98 (2010). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21137066

Gene Symbol DDX39B
Official Gene Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
Alias Symbols BAT1, UAP56, D6S81E
NCBI Gene Id 7919
Protein Name Spliceosome RNA helicase DDX39B
Description of Target BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly. A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. This protein is a negative regulator of inflammation. It is also thought to be a translation initiation factor. This gene is a strong candidate gene for rheumatoid arthritis. There are multiple alternatively spliced transcript variants known for this gene but only two have been fully described. Both of these variants encode the same isoform. This gene has been found to have multiple polyadenylation sites.
Swissprot Id Q13838
Protein Accession # NP_542165
Nucleotide Accession # NM_080598
Protein Size (# AA) 428
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BAT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BAT1.
Protein Interactions THOC3; THOC2; ALYREF; NCBP1; STAU1; SHFM1; UBC; MDM2; WWOX; SUZ12; EED; RNF2; BMI1; RBBP4; C12orf10; NDRG1; HSPD1; GSR; SRPK2; UBD; VCAM1; ITGA4; IL7R; FN1; ATF2; BARD1; WIBG; MAGOHB; WDR74; VPS33B; LSM4; THOC1; RBM8A; DHX38; TXNL1; UBE3A; RPS7; EIF4A2; R
  1. What is the species homology for "BAT1 Antibody - C-terminal region (ARP36372_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "BAT1 Antibody - C-terminal region (ARP36372_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BAT1 Antibody - C-terminal region (ARP36372_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BAT1 Antibody - C-terminal region (ARP36372_P050)"?

    This target may also be called "BAT1, UAP56, D6S81E" in publications.

  5. What is the shipping cost for "BAT1 Antibody - C-terminal region (ARP36372_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BAT1 Antibody - C-terminal region (ARP36372_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BAT1 Antibody - C-terminal region (ARP36372_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BAT1 Antibody - C-terminal region (ARP36372_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DDX39B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DDX39B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DDX39B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DDX39B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DDX39B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DDX39B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BAT1 Antibody - C-terminal region (ARP36372_P050)
Your Rating
We found other products you might like!