Catalog No: OPCA15384
Price: $0.00
SKU
OPCA15384
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ BANF1 Recombinant Protein (Human) (OPCA15384)
Datasheets/Manuals | Printable datasheet for OPCA15384 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 32509 |
Gene Full Name | barrier to autointegration factor 1 |
---|---|
Alias Symbols | BAF, NGPS, BCRP1, D14S1460 |
NCBI Gene Id | 8815 |
Protein Name | barrier-to-autointegration factor |
Description of Target | The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both |
Uniprot ID | O75531 |
Protein Accession # | NP_001137457.1 |
Nucleotide Accession # | NM_001143985.1 |
Protein Size (# AA) | 89 |
Write Your Own Review