BAMA Recombinant Protein (Klebsiella pneumoniae) (OPCA04661)

Catalog No: OPCA04661

Product Info

• Predicted Species Reactivity: Klebsiella pneumoniae
• Product Format: Lyophilized from 10mM Tris-HCI, 1mM EDTA, 6% Trehalose, pH 8.0.
• Additional Information: Species Specificity Detail: Klebsiella pneumoniae (strain 342)
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Concentration: Varies by lot. See vial for concentration.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Partial Protein: FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG
• Source: E.coli
• Tag: N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged
• Reference: Complete genome sequence of the N2-fixing broad host range endophyte Klebsiella pneumoniae 342 and virulence predictions verified in mice.Fouts D.E., Tyler H.L., DeBoy R.T., Daugherty S., Ren Q., Badger J.H., Durkin A.S., Huot H., Shrivastava S., Kothari S., Dodson R.J., Mohamoud Y., Khouri H., Roesch L.F.W., Krogfelt K.A., Struve C., Triplett E.W., Methe B.A.PLoS Genet. 4:E1000141-E1000141(2008)

Target Info

• Gene Symbol: BAMA
• Alias Symbols: bamA, yaeT, KPK_4543Outer membrane protein assembly factor BamA
• Protein Name: Outer membrane protein assembly factor BamA
• Description of Target: Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery.
• Uniprot ID: B5Y1J4
• Protein Accession #: WP_012542808
• Nucleotide Accession #: NC_011283
• Protein Size (# AA): Recombinant
• Molecular Weight: 34.5kDa