Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP61996_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61996_P050-FITC Conjugated

ARP61996_P050-HRP Conjugated

ARP61996_P050-Biotin Conjugated

BAG5 Antibody - C-terminal region (ARP61996_P050)

Rating:
100% of 100
Catalog#: ARP61996_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101215 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Complete computational species homology data Anti-BAG5 (ARP61996_P050)
Peptide Sequence Synthetic peptide located within the following region: LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BAG5 (ARP61996_P050) antibody is Catalog # AAP61996 (Previous Catalog # AAPP48333)
Datasheets/Manuals Printable datasheet for anti-BAG5 (ARP61996_P050) antibody
Sample Type Confirmation

BAG5 is supported by BioGPS gene expression data to be expressed in HeLa

Publications

Yue, X; Zhao, Y; Huang, G; Li, J; Zhu, J; Feng, Z; Hu, W; A novel mutant p53 binding partner BAG5 stabilizes mutant p53 and promotes mutant p53 GOFs in tumorigenesis. 2, 16039 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 27807478

Gene Symbol BAG5
Official Gene Full Name BCL2-associated athanogene 5
Alias Symbols BAG-5
NCBI Gene Id 9529
Protein Name BAG family molecular chaperone regulator 5
Description of Target The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene.
Swissprot Id Q9UL15-2
Protein Accession # NP_001015049
Nucleotide Accession # NM_001015049
Protein Size (# AA) 488
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BAG5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BAG5.
Protein Interactions CCDC155; FAM118B; THAP1; BANP; MAD1L1; TP53; TRIM27; FAM96B; MAD2L1; DLG5; UBC; LATS2; SOX2; MMS19; CIRBP; LRRK2; CUL3; FBXO25; PARK2; HSPA4; SNCA; STUB1; OTUD4; UIMC1; BAG5;
Write Your Own Review
You're reviewing:BAG5 Antibody - C-terminal region (ARP61996_P050)
Your Rating