Catalog No: ARP61996_P050
Price: $0.00
SKU
ARP61996_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BAG5 (ARP61996_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL
Concentration0.5 mg/ml
Blocking PeptideFor anti-BAG5 (ARP61996_P050) antibody is Catalog # AAP61996 (Previous Catalog # AAPP48333)
Sample Type Confirmation

BAG5 is supported by BioGPS gene expression data to be expressed in HeLa

Publications

A novel mutant p53 binding partner BAG5 stabilizes mutant p53 and promotes mutant p53 GOFs in tumorigenesis. Cell Discov. 2, 16039 (2016). 27807478

Gene SymbolBAG5
Gene Full NameBCL2-associated athanogene 5
Alias SymbolsBAG-5
NCBI Gene Id9529
Protein NameBAG family molecular chaperone regulator 5
Description of TargetThe protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene.
Uniprot IDQ9UL15-2
Protein Accession #NP_001015049
Nucleotide Accession #NM_001015049
Protein Size (# AA)488
Molecular Weight56kDa
Protein InteractionsCCDC155; FAM118B; THAP1; BANP; MAD1L1; TP53; TRIM27; FAM96B; MAD2L1; DLG5; UBC; LATS2; SOX2; MMS19; CIRBP; LRRK2; CUL3; FBXO25; PARK2; HSPA4; SNCA; STUB1; OTUD4; UIMC1; BAG5;
  1. What is the species homology for "BAG5 Antibody - C-terminal region (ARP61996_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig".

  2. How long will it take to receive "BAG5 Antibody - C-terminal region (ARP61996_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BAG5 Antibody - C-terminal region (ARP61996_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BAG5 Antibody - C-terminal region (ARP61996_P050)"?

    This target may also be called "BAG-5" in publications.

  5. What is the shipping cost for "BAG5 Antibody - C-terminal region (ARP61996_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BAG5 Antibody - C-terminal region (ARP61996_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BAG5 Antibody - C-terminal region (ARP61996_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BAG5 Antibody - C-terminal region (ARP61996_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BAG5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BAG5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BAG5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BAG5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BAG5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BAG5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BAG5 Antibody - C-terminal region (ARP61996_P050)
Your Rating
We found other products you might like!