Search Antibody, Protein, and ELISA Kit Solutions

BAG5 Antibody - C-terminal region (ARP61996_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP61996_P050-FITC Conjugated

ARP61996_P050-HRP Conjugated

ARP61996_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
BCL2-associated athanogene 5
NCBI Gene Id:
Protein Name:
BAG family molecular chaperone regulator 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101215 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BAG5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BAG5.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Complete computational species homology data:
Anti-BAG5 (ARP61996_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEEL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BAG5 (ARP61996_P050) antibody is Catalog # AAP61996 (Previous Catalog # AAPP48333)
Printable datasheet for anti-BAG5 (ARP61996_P050) antibody
Sample Type Confirmation:

BAG5 is supported by BioGPS gene expression data to be expressed in HeLa


Yue, X; Zhao, Y; Huang, G; Li, J; Zhu, J; Feng, Z; Hu, W; A novel mutant p53 binding partner BAG5 stabilizes mutant p53 and promotes mutant p53 GOFs in tumorigenesis. 2, 16039 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 27807478

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: BAG5 antibody - C-terminal region (ARP61996_P050) in siRUVBL1 transfected human Saos2 cells using Western Blot
Product Page for BAG5 antibody - C-terminal region (ARP61996_P050)

Researcher: Wenwei Hu, Xuetian Yue, Rutgers Cancer Institute of New Jersey.
Application: Western Blotting
Species + Tissue/Cell type: Lane
1: 20ug siRUVBL1 transfected human Saos2 cells Lane
2: 20ug untransfected human Saos2 cells
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:3000

How do Aviva's reagents play a role in your experimental goals? Excellent
How would you rate this antibody on a scale from 1-5 (5=best) nad why? 5
Would you use this antibody in future experiment? Yes
Have you used another antibody which has worked in your application? Not yet.
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, the band is specific and clear.
How did you store the antibody after re-suspension? Stored at -20C.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): 1)human, 2) human lung cancer cell H1299, 3)20ug
How many different experimental trials were conducted using the antibody sample? 3
How was this sample prepared? Cells were transfected with siRNA either control or siRuvbl2, then lyzed in cell lysis buffer with protease inhibitor.
Primary antibody dilution and incubation time: 1:1000 incubated overnight
Secondary antibody used and dilution and incubation time: Anti-rabbit IgG-HRP, 1:3000, 1h
What controls were used in your experiment (positive/negative)? Untransfected cells, siRUVBL1 cells
Please include your detailed WB Procedure/Protocol here: 20ug of protein was loaded on SDS-Page mini-gel and eletrophorese according to standard protocols. Transfer proteins from the gel to a PVDF membrane. After transfer, block the membrane with 5% non-fat milk for 1h,. Dilute the antibody with blocking solutionat 1:1000 and incubate overnight at 4C. After incubation, wash 3 times with PBST, 5min/wash. Incubate the membrane with 1:3000 anti-rabbit antibody at room temperature for 1h. Wash the membrane 3 times with PBST, 5min/wash. Incubate membrane in ECL solution and then visualized with film.
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...