BAG1 Antibody - middlel region (ARP89672_P050)

Catalog No: ARP89672_P050

Host: Rabbit
Target Name: BAG1
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse BAG1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSNPEEEVELKK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BAG1 (ARP89672_P050) antibody is Catalog # AAP89672

Target Info

• Gene Symbol: BAG1
• Gene Full Name: BCL2-associated athanogene 1
• Alias Symbols: Ra, BAG-1, Rap46
• NCBI Gene Id: 12017
• Protein Name: BAG family molecular chaperone regulator 1
• Description of Target: The oncogene Bcl2 encodes a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to Bcl2 protein and is referred to as Bcl2-associated athanogene. It enhances the anti-apoptotic effects of Bcl2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least two protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site and an alternative, downstream, AUG translation initiation site.
• Uniprot ID: Q60739
• Protein Accession #: NP_001165210.1
• Nucleotide Accession #: NM_001171739.1
• Protein Size (# AA): 355
• Molecular Weight: 40 kDa