Search Antibody, Protein, and ELISA Kit Solutions

BAG1 Antibody - middlel region (ARP89672_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
BCL2-associated athanogene 1
NCBI Gene Id:
Protein Name:
BAG family molecular chaperone regulator 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BAG-1, Rap46
Description of Target:
The oncogene Bcl2 encodes a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to Bcl2 protein and is referred to as Bcl2-associated athanogene. It enhances the anti-apoptotic effects of Bcl2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least two protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site and an alternative, downstream, AUG translation initiation site.
Protein Size (# AA):
Molecular Weight:
40 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BAG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BAG1.
The immunogen is a synthetic peptide directed towards the middle region of mouse BAG1
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: VPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSNPEEEVELKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BAG1 (ARP89672_P050) antibody is Catalog # AAP89672
Printable datasheet for anti-BAG1 (ARP89672_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...