BAFF R Protein (OPPA00688)

Catalog No: OPPA00688 (Formerly GWB-5FA36E)

Size:10UG

Product Info

• Predicted Species Reactivity: Human
• Product Format: Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Host: E. Coli
• Additional Information: Solubility: It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
  Biological Activity: Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 ug/ml in the presence of 1.0ug/ml of human soluble BAFF.
  Product Introduction: B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
  Product Description: B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques.
• Reconstitution and Storage: Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.
• Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Peptide Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.

Target Info

• Gene Symbol: BAFF R
• Alias Symbols: BAFFR, CD268, CVID4, BAFF-R, BROMIX, prolixin
• NCBI Gene Id: 115650
• Protein Name: Tumor necrosis factor receptor superfamily member 13C
• Description of Target: Recombinant Human BAFF (BLyS) Receptor
• Uniprot ID: Q96RJ3
• Protein Accession #: NP_443177.1
• Protein Size (# AA): Recombinant