Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30278_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30278_P050-FITC Conjugated

ARP30278_P050-HRP Conjugated

ARP30278_P050-Biotin Conjugated

BAD Antibody - middle region (ARP30278_P050)

Catalog#: ARP30278_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-111517 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-BAD (ARP30278_P050)
Peptide SequenceSynthetic peptide located within the following region: GAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGREL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-BAD (ARP30278_P050) antibody is Catalog # AAP30278
Datasheets/ManualsPrintable datasheet for anti-BAD (ARP30278_P050) antibody
Sample Type Confirmation

BAD is strongly supported by BioGPS gene expression data to be expressed in 721_B

Publications

Mishra, SR; Parmar, MS; Yadav, VP; Reshma, R; Bharati, J; Bharti, MK; Paul, A; Chouhan, VS; Taru Sharma, G; Singh, G; Sarkar, M; Expression and localization of angiopoietin family in corpus luteum during different stages of oestrous cycle and modulatory role of angiopoietins on steroidogenesis, angiogenesis and survivability of cultured buffalo luteal cells. 51, 855-869 (2016). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27569719

Mishra, SR; Thakur, N; Somal, A; Parmar, MS; Yadav, VP; Bharati, J; Bharti, MK; Paul, A; Verma, MR; Chouhan, VS; Sharma, GT; Singh, G; González, LA; D'Occhio, MJ; Sarkar, M; Expression and localization of angiopoietin family in buffalo ovarian follicles during different stages of development and modulatory role of angiopoietins on steroidogenesis and survival of cultured buffalo granulosa cells. 86, 1818-33 (2016). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27374424

Gene SymbolBAD
Official Gene Full NameBCL2-associated agonist of cell death
Alias SymbolsBBC2, BCL2L8
NCBI Gene Id572
Protein NameBcl2 antagonist of cell death
Description of TargetThe protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.
Swissprot IdQ92934
Protein Accession #NP_004313
Nucleotide Accession #NM_004322
Protein Size (# AA)168
Molecular Weight18kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express BAD.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express BAD.
Protein InteractionsBCL2L1; BCL2; AKT1; PAK1; BMH1; YWHAB; SFN; YWHAZ; RAF1; PRKACA; BRAF; ARAF; CREB3L3; STEAP3; YWHAQ; KEAP1; YWHAH; YWHAE; PRDX2; CDKN1A; VCP; SNCA; PPP1CA; BAX; SUMO2; YWHAG; PIM3; MCL1; RPS6KA5; PAK7; BCL2L10; WASF1; HRK; MAP2K5; BCL2L2; RPS6KA2; RPS6KA1
Write Your Own Review
You're reviewing:BAD Antibody - middle region (ARP30278_P050)
Your Rating
Aviva HIS tag Deal
Free Microscope
Aviva Live Chat
Aviva Pathways