Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30278_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30278_P050-FITC Conjugated

ARP30278_P050-HRP Conjugated

ARP30278_P050-Biotin Conjugated

BAD Antibody - middle region (ARP30278_P050)

Catalog#: ARP30278_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111517 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-BAD (ARP30278_P050)
Peptide Sequence Synthetic peptide located within the following region: GAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGREL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BAD (ARP30278_P050) antibody is Catalog # AAP30278
Datasheets/Manuals Printable datasheet for anti-BAD (ARP30278_P050) antibody
Sample Type Confirmation

BAD is strongly supported by BioGPS gene expression data to be expressed in 721_B

Publications

Mishra, SR; Parmar, MS; Yadav, VP; Reshma, R; Bharati, J; Bharti, MK; Paul, A; Chouhan, VS; Taru Sharma, G; Singh, G; Sarkar, M; Expression and localization of angiopoietin family in corpus luteum during different stages of oestrous cycle and modulatory role of angiopoietins on steroidogenesis, angiogenesis and survivability of cultured buffalo luteal cells. 51, 855-869 (2016). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27569719

Mishra, SR; Thakur, N; Somal, A; Parmar, MS; Yadav, VP; Bharati, J; Bharti, MK; Paul, A; Verma, MR; Chouhan, VS; Sharma, GT; Singh, G; González, LA; D'Occhio, MJ; Sarkar, M; Expression and localization of angiopoietin family in buffalo ovarian follicles during different stages of development and modulatory role of angiopoietins on steroidogenesis and survival of cultured buffalo granulosa cells. 86, 1818-33 (2016). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27374424

Gene Symbol BAD
Official Gene Full Name BCL2-associated agonist of cell death
Alias Symbols BBC2, BCL2L8
NCBI Gene Id 572
Protein Name Bcl2 antagonist of cell death
Description of Target The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.
Swissprot Id Q92934
Protein Accession # NP_004313
Nucleotide Accession # NM_004322
Protein Size (# AA) 168
Molecular Weight 18kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BAD.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BAD.
Protein Interactions BCL2L1; BCL2; AKT1; PAK1; BMH1; YWHAB; SFN; YWHAZ; RAF1; PRKACA; BRAF; ARAF; CREB3L3; STEAP3; YWHAQ; KEAP1; YWHAH; YWHAE; PRDX2; CDKN1A; VCP; SNCA; PPP1CA; BAX; SUMO2; YWHAG; PIM3; MCL1; RPS6KA5; PAK7; BCL2L10; WASF1; HRK; MAP2K5; BCL2L2; RPS6KA2; RPS6KA1
  1. What is the species homology for "BAD Antibody - middle region (ARP30278_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "BAD Antibody - middle region (ARP30278_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BAD Antibody - middle region (ARP30278_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BAD Antibody - middle region (ARP30278_P050)"?

    This target may also be called "BBC2, BCL2L8" in publications.

  5. What is the shipping cost for "BAD Antibody - middle region (ARP30278_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BAD Antibody - middle region (ARP30278_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BAD Antibody - middle region (ARP30278_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BAD Antibody - middle region (ARP30278_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BAD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BAD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BAD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BAD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BAD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BAD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BAD Antibody - middle region (ARP30278_P050)
Your Rating
We found other products you might like!