Search Antibody, Protein, and ELISA Kit Solutions

BAD Antibody - middle region (ARP30278_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP30278_P050-FITC Conjugated

ARP30278_P050-HRP Conjugated

ARP30278_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-111517 from Santa Cruz Biotechnology.
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-BAD (ARP30278_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGREL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BAD (ARP30278_P050) antibody is Catalog # AAP30278
Printable datasheet for anti-BAD (ARP30278_P050) antibody
Sample Type Confirmation:

BAD is strongly supported by BioGPS gene expression data to be expressed in 721_B


Mishra, SR; Parmar, MS; Yadav, VP; Reshma, R; Bharati, J; Bharti, MK; Paul, A; Chouhan, VS; Taru Sharma, G; Singh, G; Sarkar, M; Expression and localization of angiopoietin family in corpus luteum during different stages of oestrous cycle and modulatory role of angiopoietins on steroidogenesis, angiogenesis and survivability of cultured buffalo luteal cells. 51, 855-869 (2016). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27569719

Mishra, SR; Thakur, N; Somal, A; Parmar, MS; Yadav, VP; Bharati, J; Bharti, MK; Paul, A; Verma, MR; Chouhan, VS; Sharma, GT; Singh, G; González, LA; D'Occhio, MJ; Sarkar, M; Expression and localization of angiopoietin family in buffalo ovarian follicles during different stages of development and modulatory role of angiopoietins on steroidogenesis and survival of cultured buffalo granulosa cells. 86, 1818-33 (2016). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27374424

Gene Symbol:
Official Gene Full Name:
BCL2-associated agonist of cell death
Alias Symbols:
NCBI Gene Id:
Protein Name:
Bcl2 antagonist of cell death
Description of Target:
The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BAD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BAD.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...