Catalog No: ARP39513_P050
Price: $0.00
SKU
ARP39513_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BACH2 (ARP39513_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BACH2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT
Concentration0.5 mg/ml
Blocking PeptideFor anti-BACH2 (ARP39513_P050) antibody is Catalog # AAP39513 (Previous Catalog # AAPP23070)
Sample Type Confirmation

BACH2 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceHong,S.W., (2008) Biochem. Biophys. Res. Commun. 365 (3), 426-432
Publications

TBL1XR1 Mutations Drive Extranodal Lymphoma by Inducing a Pro-tumorigenic Memory Fate. Cell. 182, 297-316.e27 (2020)

Gene SymbolBACH2
Gene Full NameBTB and CNC homology 1, basic leucine zipper transcription factor 2
Alias SymbolsIMD60, BTBD25
NCBI Gene Id60468
Protein NameTranscription regulator protein BACH2
Description of TargetBACH2 belongs to the bZIP family. It is a transcriptional regulator that acts as repressor or activator. The protein binds to Maf recognition elements (MARE) and play important roles in coordinating transcription activation and repression by MAFK.
Uniprot IDQ9BYV9
Protein Accession #NP_068585
Nucleotide Accession #NM_021813
Protein Size (# AA)841
Molecular Weight93kDa
Protein InteractionsBATF3; MAFF; NFE2L3; NFE2L1; MAFG; DDIT3; COPS6; SUMO1; UBC; ARRB1; NCOR2; PATZ1; MAFK; BCL6;
  1. What is the species homology for "BACH2 Antibody - middle region (ARP39513_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "BACH2 Antibody - middle region (ARP39513_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BACH2 Antibody - middle region (ARP39513_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BACH2 Antibody - middle region (ARP39513_P050)"?

    This target may also be called "IMD60, BTBD25" in publications.

  5. What is the shipping cost for "BACH2 Antibody - middle region (ARP39513_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BACH2 Antibody - middle region (ARP39513_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BACH2 Antibody - middle region (ARP39513_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "93kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BACH2 Antibody - middle region (ARP39513_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BACH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BACH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BACH2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BACH2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BACH2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BACH2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BACH2 Antibody - middle region (ARP39513_P050)
Your Rating
We found other products you might like!