Search Antibody, Protein, and ELISA Kit Solutions

BAAT Antibody (OAAL00024)

100 ug
$315.00
In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
Human
Product Format:
Liquid
Clonality:
Monoclonal
Clone:
1E4
Isotype:
IgG2a Kappa
Host:
Mouse
Application:
WB
Reconstitution and Storage:
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Replacement Item:
This antibody may replace item sc-100475 from Santa Cruz Biotechnology.
Immunogen:
BAAT (NP_001692, 258 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Peptide Sequence:
Synthetic peptide located within the following region: NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
Datasheets/Manuals:
Printable datasheet for anti-BAAT (OAAL00024) antibody
Formulation:
In 1x PBS, pH 7.4
Gene Symbol:
BAAT
Official Gene Full Name:
bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase)
Alias Symbols:
BACAT, BAT, FLJ20300, MGC104432
NCBI Gene Id:
126
Description of Target:
The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Protein Accession #:
NP_001692
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BAAT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BAAT.

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...