- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for BAAT Antibody (OAAL00024) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 1E4 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | BAAT (NP_001692, 258 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | BAAT |
|---|---|
| Gene Full Name | bile acid-CoA:amino acid N-acyltransferase |
| Alias Symbols | BACAT;BACD1;BAT;bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase);bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase);bile acid-CoA thioesterase;bile acid-CoA:amino acid N-acyltransferase;choloyl-CoA hydrolase;HCHO;long-chain fatty-acyl-CoA hydrolase. |
| NCBI Gene Id | 570 |
| Protein Name | bile acid-CoA:amino acid N-acyltransferase [Homo sapiens]|Homo sapiens bile acid-CoA:amino acid N-acyltransferase (BAAT), transcript variant 1, mRNA |
| Description of Target | The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_001692 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_001701 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "BAAT Antibody (OAAL00024)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "BAAT Antibody (OAAL00024)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "BAAT Antibody (OAAL00024)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "BAAT Antibody (OAAL00024)"?
This target may also be called "BACAT;BACD1;BAT;bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase);bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase);bile acid-CoA thioesterase;bile acid-CoA:amino acid N-acyltransferase;choloyl-CoA hydrolase;HCHO;long-chain fatty-acyl-CoA hydrolase." in publications.
-
What is the shipping cost for "BAAT Antibody (OAAL00024)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "BAAT Antibody (OAAL00024)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "BAAT Antibody (OAAL00024)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "BAAT Antibody (OAAL00024)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BAAT"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BAAT"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BAAT"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BAAT"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BAAT"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BAAT"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
