Search Antibody, Protein, and ELISA Kit Solutions

BAAT Antibody - N-terminal region (ARP45686_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45686_P050-FITC Conjugated

ARP45686_P050-HRP Conjugated

ARP45686_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
NCBI Gene Id:
Protein Name:
Bile acid-CoA:amino acid N-acyltransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BACAT, BAT, FLJ20300, MGC104432
Replacement Item:
This antibody may replace item sc-100475 from Santa Cruz Biotechnology.
Description of Target:
BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BAAT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BAAT.
The immunogen is a synthetic peptide directed towards the N terminal region of human BAAT
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-BAAT (ARP45686_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BAAT (ARP45686_P050) antibody is Catalog # AAP45686 (Previous Catalog # AAPP26691)
Printable datasheet for anti-BAAT (ARP45686_P050) antibody
Target Reference:
Tougou,K., (2007) Drug Metab. Pharmacokinet. 22 (2), 125-128

Aleksunes, L. M., Yeager, R. L., Wen, X., Cui, J. Y. & Klaassen, C. D. Repression of hepatobiliary transporters and differential regulation of classic and alternative bile acid pathways in mice during pregnancy. Toxicol. Sci. 130, 257-68 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22903823

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...