Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP45686_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45686_P050-FITC Conjugated

ARP45686_P050-HRP Conjugated

ARP45686_P050-Biotin Conjugated

BAAT Antibody - N-terminal region (ARP45686_P050)

Catalog#: ARP45686_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100475 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BAAT
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-BAAT (ARP45686_P050)
Peptide Sequence Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BAAT (ARP45686_P050) antibody is Catalog # AAP45686 (Previous Catalog # AAPP26691)
Datasheets/Manuals Printable datasheet for anti-BAAT (ARP45686_P050) antibody
Target Reference Tougou,K., (2007) Drug Metab. Pharmacokinet. 22 (2), 125-128
Publications

Aleksunes, L. M., Yeager, R. L., Wen, X., Cui, J. Y. & Klaassen, C. D. Repression of hepatobiliary transporters and differential regulation of classic and alternative bile acid pathways in mice during pregnancy. Toxicol. Sci. 130, 257-68 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22903823

Gene Symbol BAAT
Official Gene Full Name Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
Alias Symbols BACAT, BAT, FLJ20300, MGC104432
NCBI Gene Id 570
Protein Name Bile acid-CoA:amino acid N-acyltransferase
Description of Target BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.
Swissprot Id Q14032
Protein Accession # NP_001692
Nucleotide Accession # NM_001701
Protein Size (# AA) 418
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BAAT.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BAAT.
Protein Interactions GOLGA8F; GOLGA8EP; GOLGA8DP; PEX5; SLC7A11;
  1. What is the species homology for "BAAT Antibody - N-terminal region (ARP45686_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "BAAT Antibody - N-terminal region (ARP45686_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BAAT Antibody - N-terminal region (ARP45686_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BAAT Antibody - N-terminal region (ARP45686_P050)"?

    This target may also be called "BACAT, BAT, FLJ20300, MGC104432" in publications.

  5. What is the shipping cost for "BAAT Antibody - N-terminal region (ARP45686_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BAAT Antibody - N-terminal region (ARP45686_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BAAT Antibody - N-terminal region (ARP45686_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BAAT Antibody - N-terminal region (ARP45686_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BAAT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BAAT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BAAT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BAAT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BAAT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BAAT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BAAT Antibody - N-terminal region (ARP45686_P050)
Your Rating
We found other products you might like!