- Gene Symbol:
- BAAT
- NCBI Gene Id:
- 570
- Official Gene Full Name:
- Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
- Protein Name:
- Bile acid-CoA:amino acid N-acyltransferase
- Swissprot Id:
- Q14032
- Protein Accession #:
- NP_001692
- Nucleotide Accession #:
- NM_001701
- Alias Symbols:
- BACAT, BAT, FLJ20300, MGC104432
- Replacement Item:
- This antibody may replace item sc-100475 from Santa Cruz Biotechnology.
- Description of Target:
- BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.
- Protein Size (# AA):
- 418
- Molecular Weight:
- 46kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express BAAT.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express BAAT.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human BAAT
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
- Complete computational species homology data:
- Anti-BAAT (ARP45686_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- GOLGA8F; GOLGA8EP; GOLGA8DP; PEX5; SLC7A11;
- Blocking Peptide:
- For anti-BAAT (ARP45686_P050) antibody is Catalog # AAP45686 (Previous Catalog # AAPP26691)
- Datasheets/Manuals:
- Printable datasheet for anti-BAAT (ARP45686_P050) antibody
- Target Reference:
- Tougou,K., (2007) Drug Metab. Pharmacokinet. 22 (2), 125-128
- Publications:
Aleksunes, L. M., Yeager, R. L., Wen, X., Cui, J. Y. & Klaassen, C. D. Repression of hepatobiliary transporters and differential regulation of classic and alternative bile acid pathways in mice during pregnancy. Toxicol. Sci. 130, 257-68 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22903823
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
