BAAT Antibody - N-terminal region (ARP45686_P050)

Catalog No: ARP45686_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-BAAT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver

Rabbit Anti-BAAT antibody
Catalog Number: ARP45686
Formalin Fixed Paraffin Embedded Tissue: Human Liver
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BAAT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BAAT (ARP45686_P050) antibody is Catalog # AAP45686 (Previous Catalog # AAPP26691)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Tougou,K., (2007) Drug Metab. Pharmacokinet. 22 (2), 125-128
• Publications:

  Aleksunes, L. M., Yeager, R. L., Wen, X., Cui, J. Y. & Klaassen, C. D. Repression of hepatobiliary transporters and differential regulation of classic and alternative bile acid pathways in mice during pregnancy. Toxicol. Sci. 130, 257-68 (2012). 22903823

Target Info

• Gene Symbol: BAAT
• Gene Full Name: Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
• Alias Symbols: BAT, HCHO, BACAT, BACD1
• NCBI Gene Id: 570
• Protein Name: Bile acid-CoA:amino acid N-acyltransferase
• Description of Target: BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: Q14032
• Protein Accession #: NP_001692
• Nucleotide Accession #: NM_001701
• Protein Size (# AA): 418
• Molecular Weight: 46 kDa
• Protein Interactions: GOLGA8F; GOLGA8EP; GOLGA8DP; PEX5; SLC7A11;