AVPR2 Recombinant Protein (Pig) (OPCA04303)

Catalog No: OPCA04303

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Sus scrofa (Pig)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS
• Protein Sequence: WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 292-370 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Molecular cloning and functional characterization of V2 [8-lysine] vasopressin and oxytocin receptors from a pig kidney cell line. Gorbulev V., Buechner H., Akhundova A., Fahrenholz F.Eur. J. Biochem. 215:1-7(1993)
• Gene Symbol: AVPR2
• Gene Full Name: vasopressin receptor 2
• Alias Symbols: antidiuretic hormone receptor;arginine vasopressin receptor 2 (nephrogenic diabetes insipidus);AVPR V2;renal-type arginine vasopressin receptor;V-2 lysine vasopressin receptor;V2R;vasopressin V2 receptor.
• NCBI Gene Id: 397462
• Protein Name: Vasopressin V2 receptor
• Description of Target: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity).
• Uniprot ID: P32307
• Protein Accession #: NP_999397
• Nucleotide Accession #: NM_214232
• Protein Size (# AA): Recombinant
• Molecular Weight: 24.7 kDa