Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF07369 (Formerly GWB-ASB132)
Size:100 ug
Price: $344.00
SKU
OAAF07369
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLiquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
ClonalityPolyclonal
IsotypeIgG
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:T288 Mouse:T279 Rat:T281
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human Aurora Kinase around the phosphorylation site of Thr288.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: DIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRM
Concentration1 mg/ml
SpecificityAurora Kinase (Phospho-Thr288) Antibody detects endogenous levels of Aurora Kinase only when phosphorylated at Thr288.
Application InfoWB 1:500~1000
IHC 1:50~100
ELISA 1:1000
Gene SymbolAURKA
Gene Full Nameaurora kinase A
Alias SymbolsAIK;ARK1;AURA;aurora 2;aurora kinase A;aurora/IPL1-like kinase;aurora/IPL1-related kinase 1;breast tumor-amplified kinase;BTAK;PPP1R47;protein phosphatase 1, regulatory subunit 47;serine/threonine protein kinase 15;Serine/threonine-protein kinase 15;serine/threonine-protein kinase 6;serine/threonine-protein kinase aurora-A;STK15;STK6;STK7.
NCBI Gene Id6790
Protein NameAurora kinase A
Description of TargetMitotic serine/threonine kinase that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Required for initial activation of CDK1 at centrosomes. Phosphorylates numerous target proteins, including ARHGEF2, BORA, BRCA1, CDC25B, DLGP5, HDAC6, KIF2A, LATS2, NDEL1, PARD3, PPP1R2, PLK1, RASSF1, TACC3, p53/TP53 and TPX2. Regulates KIF2A tubulin depolymerase activity. Required for normal axon formation. Plays a role in microtubule remodeling during neurite extension. Important for microtubule formation and/or stabilization. Also acts as a key regulatory component of the p53/TP53 pathway, and particularly the checkpoint-response pathways critical for oncogenic transformation of cells, by phosphorylating and stabilizing p53/TP53. Phosphorylates its own inhibitors, the protein phosphatase type 1 (PP1) isoforms, to inhibit their activity. Necessary for proper cilia disassembly prior to mitosis.
Uniprot IDO14965
Molecular Weight45 kDa
  1. What is the species homology for "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)" provided in?

    This item is provided in "Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)"?

    This target may also be called "AIK;ARK1;AURA;aurora 2;aurora kinase A;aurora/IPL1-like kinase;aurora/IPL1-related kinase 1;breast tumor-amplified kinase;BTAK;PPP1R47;protein phosphatase 1, regulatory subunit 47;serine/threonine protein kinase 15;Serine/threonine-protein kinase 15;serine/threonine-protein kinase 6;serine/threonine-protein kinase aurora-A;STK15;STK6;STK7." in publications.

  5. What is the shipping cost for "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AURKA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AURKA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AURKA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AURKA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AURKA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AURKA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Aurora Kinase Antibody (Phospho-Thr288) (OAAF07369)
Your Rating
We found other products you might like!