SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP53573_P050
Price: $0.00
SKU
ARP53573_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AURKC (ARP53573_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolAURKC
Gene Full Nameaurora kinase C
Alias SymbolsAIE2, AIK3, ARK3, AurC, SPGF5, STK13, HEL-S-90, aurora-C
NCBI Gene Id6795
Protein NameAurora kinase C
Description of TargetThis gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.
Uniprot IDQ9UQB9
Protein Accession #NP_001015878
Nucleotide Accession #NM_001015878
Protein Size (# AA)309
Molecular Weight36 kDa
Protein InteractionsSRPK1; AURKB; HIST1H3A; INCENP; BIRC5; TACC2; UBC; HSP90AA1; BRCA1; LNX1; NEDD4L; NEDD4; CENPA;
  1. What is the species homology for "AURKC Antibody (ARP53573_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "AURKC Antibody (ARP53573_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "AURKC Antibody (ARP53573_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AURKC Antibody (ARP53573_P050)"?

    This target may also be called "AIE2, AIK3, ARK3, AurC, SPGF5, STK13, HEL-S-90, aurora-C" in publications.

  5. What is the shipping cost for "AURKC Antibody (ARP53573_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AURKC Antibody (ARP53573_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AURKC Antibody (ARP53573_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AURKC Antibody (ARP53573_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AURKC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AURKC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AURKC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AURKC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AURKC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AURKC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AURKC Antibody (ARP53573_P050)
Your Rating
We found other products you might like!