Search Antibody, Protein, and ELISA Kit Solutions

AUH Antibody - C-terminal region : FITC (ARP72398_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72398_P050 Unconjugated

ARP72398_P050-HRP Conjugated

ARP72398_P050-Biotin Conjugated

Gene Symbol:
AUH
NCBI Gene Id:
549
Swissprot Id:
Q13825-2
Protein Accession #:
XP_005252125
Alias Symbols:
AUH,
Replacement Item:
This antibody may replace item sc-82518 from Santa Cruz Biotechnology.
Description of Target:
The methylglutaconyl-CoA hydratase, mitochondrial protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity. A possible subcellular localization in the mitochondria has been demonstrated for the mouse homolog of this protein which shares 92% identity with the human protein. It has been suggested that AUH may have a novel role as a mitochondrial located AU-binding protein. Human AUH is expressed as a single mRNA species of 1.8 kb, and translated as a 40-kDa precursor protein which is subsequently processed to a 32-kDa mature form.
Protein Size (# AA):
310
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AUH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AUH.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AUH
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
UBC; AUH;
Blocking Peptide:
For anti-AUH (ARP72398_P050-FITC) antibody is Catalog # AAP72398
Datasheets/Manuals:
Printable datasheet for anti-AUH (ARP72398_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...