ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP33797_T100-HRP
Size:100ul
Price: $384.00
SKU
ARP33797_T100-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)

Datasheets/ManualsPrintable datasheet for anti-ATP7A (ARP33797_T100-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATP7A
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATP7A (ARP33797_T100-HRP) antibody is Catalog # AAP33797 (Previous Catalog # AAPP04863)
SpecificityThe immunizing peptide used to raise this antibody is 100% homologous to isoform 3 (503aa 54.3kDa), 1 (1514aa, 165kDa), 2 (1581aa, 172kDa) and 5 (1422aa, 154kDa) of human ATP7A.
ReferenceUeta,A., Unpublished
Gene SymbolATP7A
Gene Full NameATPase, Cu++ transporting, alpha polypeptide
Alias SymbolsMK, MNK, DSMAX, SMAX3
NCBI Gene Id538
Protein NameATP7A protein EMBL BAC82353.1
Description of TargetThe ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.
Uniprot IDQ04656
Protein Accession #NP_000043
Nucleotide Accession #NM_000052.5
Protein Size (# AA)1500aa
Molecular Weight163kDa
Protein InteractionsACIN1; UBC; COMMD1; CLU; ATOX1; PDZD11; CP; GLRX;
  1. What is the species homology for "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep".

  2. How long will it take to receive "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)"?

    This target may also be called "MK, MNK, DSMAX, SMAX3" in publications.

  5. What is the shipping cost for "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "163kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP7A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP7A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP7A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP7A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP7A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP7A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP7A Antibody - N-terminal region : HRP (ARP33797_T100-HRP)
Your Rating
We found other products you might like!