ATP7A Antibody - N-terminal region (ARP33797_T100)

Catalog No: ARP33797_T100

Host: Rabbit
Target Name: ATP7A
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP7A
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ATP7A (ARP33797_T100) antibody is Catalog # AAP33797 (Previous Catalog # AAPP04863)
• Specificity: The immunizing peptide used to raise this antibody is 100% homologous to isoform 3 (503aa 54.3kDa), 1 (1514aa, 165kDa), 2 (1581aa, 172kDa) and 5 (1422aa, 154kDa) of human ATP7A.
• Reference: Ueta,A., Unpublished
• Publications:

  Cytotoxic phenanthroline derivatives alter metallostasis and redox homeostasis in neuroblastoma cells. Oncotarget. 9, 36289-36316 (2018). 30555630

• Description:
  View product citations for ATP7A Antibody - N-terminal region (ARP33797_T100) on CiteAb

Target Info

• Gene Symbol: ATP7A
• Gene Full Name: ATPase, Cu++ transporting, alpha polypeptide
• Alias Symbols: MK, MNK, DSMAX, SMAX3
• NCBI Gene Id: 538
• Protein Name: ATP7A protein EMBL BAC82353.1
• Description of Target: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.
• Uniprot ID: Q04656
• Protein Accession #: NP_000043
• Nucleotide Accession #: NM_000052.5
• Protein Size (# AA): 1500aa
• Molecular Weight: 163kDa
• Protein Interactions: ACIN1; UBC; COMMD1; CLU; ATOX1; PDZD11; CP; GLRX;