Loading...
Catalog No: ARP58590_P050
Price: $0.00
SKU
ARP58590_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATP6V1E2 (ARP58590_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ATP6V1E2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 86%; Sheep: 79%
Peptide SequenceSynthetic peptide located within the following region: LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATP6V1E2 (ARP58590_P050) antibody is Catalog # AAP58590 (Previous Catalog # AAPP35710)
SubunitE 2
ReferenceHillier,L.W., (2005) Nature 434 (7034), 724-731
Gene SymbolATP6V1E2
Gene Full NameATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2
Alias SymbolsVMA4, ATP6E1, ATP6EL2, ATP6V1EL2
NCBI Gene Id90423
Protein NameV-type proton ATPase subunit E 2
Description of TargetATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
Uniprot IDQ96A05
Protein Accession #NP_542384
Nucleotide Accession #NM_080653
Protein Size (# AA)226
Molecular Weight26kDa
Protein InteractionsC9orf16; ATP6V1G1; UBC;
  1. What is the species homology for "ATP6V1E2 Antibody - middle region (ARP58590_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "ATP6V1E2 Antibody - middle region (ARP58590_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP6V1E2 Antibody - middle region (ARP58590_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP6V1E2 Antibody - middle region (ARP58590_P050)"?

    This target may also be called "VMA4, ATP6E1, ATP6EL2, ATP6V1EL2" in publications.

  5. What is the shipping cost for "ATP6V1E2 Antibody - middle region (ARP58590_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP6V1E2 Antibody - middle region (ARP58590_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP6V1E2 Antibody - middle region (ARP58590_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "26kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP6V1E2 Antibody - middle region (ARP58590_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP6V1E2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP6V1E2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP6V1E2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP6V1E2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP6V1E2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP6V1E2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP6V1E2 Antibody - middle region (ARP58590_P050)
Your Rating