Search Antibody, Protein, and ELISA Kit Solutions

ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58589_P050-FITC Conjugated

ARP58589_P050-HRP Conjugated

ARP58589_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
NCBI Gene Id:
Protein Name:
V-type proton ATPase subunit C 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ATP6C, ATP6D, FLJ20057, VATC, Vma5
Replacement Item:
This antibody may replace item sc-36789 from Santa Cruz Biotechnology.
Description of Target:
ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATP6V1C1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATP6V1C1.
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1C1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-ATP6V1C1 (ARP58589_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ATP6V1C1 (ARP58589_P050) antibody is Catalog # AAP58589 (Previous Catalog # AAPP35806)
Printable datasheet for anti-ATP6V1C1 (ARP58589_P050) antibody
C 1
Target Reference:
Rao,V.N., (2006) Nat. Cell Biol. 8 (2), 124-136

Meo-Evoli, N; Almacellas, E; Massucci, FA; Gentilella, A; Ambrosio, S; Kozma, SC; Thomas, G; Tauler, A; V-ATPase: a master effector of E2F1-mediated lysosomal trafficking, mTORC1 activation and autophagy. 6, 28057-70 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26356814

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...