- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-ATP6V1C1 (ARP58589_P050) antibody |
---|
Tested Species Reactivity | Human | ||||||
---|---|---|---|---|---|---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish | ||||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
Clonality | Polyclonal | ||||||
Host | Rabbit | ||||||
Application | WB | ||||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1C1 | ||||||
Purification | Affinity Purified | ||||||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% | ||||||
Peptide Sequence | Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma | ||||||
Concentration | 0.5 mg/ml | ||||||
Blocking Peptide | For anti-ATP6V1C1 (ARP58589_P050) antibody is Catalog # AAP58589 (Previous Catalog # AAPP35806) | ||||||
Subunit | C 1 | ||||||
Enhanced Validation |
| ||||||
Reference | Rao,V.N., (2006) Nat. Cell Biol. 8 (2), 124-136 | ||||||
Publications | Isoform-specific gene disruptions reveal a role for the V-ATPase subunit a4 isoform in the invasiveness of 4T1-12B breast cancer cells. J Biol Chem. 294, 11248-11258 (2019). 31167791 V-ATPase: a master effector of E2F1-mediated lysosomal trafficking, mTORC1 activation and autophagy. Oncotarget. 6, 28057-70 (2015). 26356814 |
Gene Symbol | ATP6V1C1 |
---|---|
Gene Full Name | ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 |
Alias Symbols | VATC, Vma5, ATP6C, ATP6D |
NCBI Gene Id | 528 |
Protein Name | V-type proton ATPase subunit C 1 |
Description of Target | ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P21283 |
Protein Accession # | NP_001686 |
Nucleotide Accession # | NM_001695 |
Protein Size (# AA) | 382 |
Molecular Weight | 42kDa |
Protein Interactions | ATP6V1C1; IVNS1ABP; ATG7; DNM1L; TSN; STAT1; SNX2; SNX1; SHMT2; SHMT1; SARS; RDX; PAWR; NASP; IDE; GTF2A1; GSPT1; CTTN; PSMG3; ANP32E; TBC1D15; SNX6; VPS35; VPS29; LUC7L2; VTA1; ARFIP1; GSPT2; UBC; UBAC2; TXNDC17; MRPS35; CISD1; VASP; TYMS; SSR1; SRSF5; A |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?
This target may also be called "VATC, Vma5, ATP6C, ATP6D" in publications.
-
What is the shipping cost for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "42kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ATP6V1C1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ATP6V1C1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ATP6V1C1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ATP6V1C1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ATP6V1C1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ATP6V1C1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.