Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP58589_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58589_P050-FITC Conjugated

ARP58589_P050-HRP Conjugated

ARP58589_P050-Biotin Conjugated

ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)

Catalog#: ARP58589_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-36789 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1C1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-ATP6V1C1 (ARP58589_P050)
Peptide Sequence Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ATP6V1C1 (ARP58589_P050) antibody is Catalog # AAP58589 (Previous Catalog # AAPP35806)
Datasheets/Manuals Printable datasheet for anti-ATP6V1C1 (ARP58589_P050) antibody
Subunit C 1
Target Reference Rao,V.N., (2006) Nat. Cell Biol. 8 (2), 124-136
Publications

Meo-Evoli, N; Almacellas, E; Massucci, FA; Gentilella, A; Ambrosio, S; Kozma, SC; Thomas, G; Tauler, A; V-ATPase: a master effector of E2F1-mediated lysosomal trafficking, mTORC1 activation and autophagy. 6, 28057-70 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26356814

Gene Symbol ATP6V1C1
Official Gene Full Name ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Alias Symbols ATP6C, ATP6D, FLJ20057, VATC, Vma5
NCBI Gene Id 528
Protein Name V-type proton ATPase subunit C 1
Description of Target ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P21283
Protein Accession # NP_001686
Nucleotide Accession # NM_001695
Protein Size (# AA) 382
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ATP6V1C1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ATP6V1C1.
Protein Interactions ATP6V1C1; IVNS1ABP; ATG7; DNM1L; TSN; STAT1; SNX2; SNX1; SHMT2; SHMT1; SARS; RDX; PAWR; NASP; IDE; GTF2A1; GSPT1; CTTN; PSMG3; ANP32E; TBC1D15; SNX6; VPS35; VPS29; LUC7L2; VTA1; ARFIP1; GSPT2; UBC; UBAC2; TXNDC17; MRPS35; CISD1; VASP; TYMS; SSR1; SRSF5; A
  1. What is the species homology for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?

    This target may also be called "ATP6C, ATP6D, FLJ20057, VATC, Vma5" in publications.

  5. What is the shipping cost for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ATP6V1C1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP6V1C1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP6V1C1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP6V1C1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP6V1C1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP6V1C1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP6V1C1 Antibody - N-terminal region (ARP58589_P050)
Your Rating