Catalog No: ARP56328_P050-Biotin
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ATP6V1B2 (ARP56328_P050-Biotin) antibody
Product Info
ReferenceChi,A., (2006) J. Proteome Res. 5 (11), 3135-3144
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1B2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATP6V1B2 (ARP56328_P050-Biotin) antibody is Catalog # AAP56328 (Previous Catalog # AAPP35501)
SubunitB, brain isoform
Gene SymbolATP6V1B2
Gene Full NameATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
Alias SymbolsDOOD, HO57, VATB, VPP3, Vma2, ZLS2, ATP6B2, ATP6B1B2
NCBI Gene Id526
Protein NameV-type proton ATPase subunit B, brain isoform
Description of TargetATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP21281
Protein Accession #NP_001684
Nucleotide Accession #NM_001693
Protein Size (# AA)511
Molecular Weight56kDa
  1. What is the species homology for "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)"?

    This target may also be called "DOOD, HO57, VATB, VPP3, Vma2, ZLS2, ATP6B2, ATP6B1B2" in publications.

  5. What is the shipping cost for "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP6V1B2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP6V1B2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP6V1B2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP6V1B2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP6V1B2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP6V1B2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP6V1B2 Antibody - N-terminal region : Biotin (ARP56328_P050-Biotin)
Your Rating
We found other products you might like!